CAZyme Information: AO090701000572-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090701000572-T-p1
• CAZy Family: GT41
• CAZyme Description: Glycosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		42215.94	4.8442

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr5_A_oryzae_RIB40:838989-840104(+)

Full Sequence      

MPGFLGWKSSSRVGRFVLLVTGTVLALALIQGVALISQPITVHVNTPSINHESLQSSPST
TPIDTTSPIVTEPAEVSQKPNYAFATIITGEGDTETEVKDAYFTATRLLTYQLLYSPQTK
SRSGHIPFLVLVTKEVPQEQRDILTKEGATVIPAETLEREWIHPKWSRWIDVLAKLNLWR
LTEFEKIAFMDADSIILHPLDDIFTDPTTDIQQTVPPREGVDDNMNITVPLPETYLLSGI
HDRWVEMALPPVPGKEFYVANNYMNAGFFVCSPSELLFNYYVSLLDTPDRFDASYPEQNL
LNFAHKTDSRMPWRELGPGWNHKPIAVSKDDLENFKSLHQKWWRPIADKDAAEYIRNTVQ
EMEDFFQHRTI

Enzyme Prediction     

No EC number prediction in AO090701000572-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	99	339	4.9e-32	0.8093385214007782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	9.14e-28	82	344	1	235	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	1.13e-21	67	345	41	338	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
132996	Glyco_transf_8	7.81e-07	163	302	74	194	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
133064	GT8_GNT1	3.21e-06	121	207	24	115	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
215090	PLN00176	1.12e-05	62	302	3	220	galactinol synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE62267.1|GT8	3.03e-277	1	371	1	371
QMW44321.1|GT8	3.39e-274	1	371	1	371
QMW32290.1|GT8	5.55e-232	7	371	7	371
QRD83739.1|GT8	5.55e-232	7	371	7	371
UDD57256.1|GT8	3.20e-231	7	371	7	371

PDB Hits     

AO090701000572-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43061|MU136_SCHPO	2.72e-22	83	365	58	362	Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug136 PE=1 SV=1
sp|Q09680|YA0C_SCHPO	4.45e-21	99	370	82	370	Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.12c PE=4 SV=1
sp|O43062|YGT9_SCHPO	5.58e-20	96	343	85	345	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1
sp|Q947G8|GOLS1_SOLLC	7.42e-09	71	371	9	283	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
sp|Q5UNW1|YR707_MIMIV	2.73e-06	81	360	3	278	Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R707 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.924401	0.075629

TMHMM  Annotations     

Start	End
13	35