CAZyme Information: AO090701000558-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090701000558-T-p1
• CAZy Family: GT4
• CAZyme Description: Extracellular alpha-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
767		85369.40	6.4615

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr5_A_oryzae_RIB40:876261-878572(+)

Full Sequence      

MPLYSSYLGAFSVFALATLGESRSSWTLGQGIEVNWQSSSQQLSIVQANKTLLATVPGQN
FLSASTGKDQWVGANGNFNYTSVDLNRCQGQNVTRVTHSSRENSVSGEDVSIQGYLQDCG
DQSIGYTMSFWVPKTLPDRVAFDVNVEPAHAPMNKLYVTFGSHASEDFYGLGAQASFASM
KNQTIPIFSREQGVGRGDQPITALEDSQSWFSGGNEFTTYTAIPQFISSAARVFYLREED
TAFSEFDFTKPNAVTVRYDALTVGGHFMQADNMLNAITMLTDYVGKMPTLPEWVDNGAIL
GIQGGQEKVERIVKEGLKQDCPVAAVWLQDWSGTHSQEAPYGNMQISRLWWNWESDSKLY
PTWAEFVQDLREEYGVKTLAYINPFVANVSSKADGYRRNLFLEATKGGYMVQNSTTNGTA
IISSGKGIQAGILDLTNQKTRAWFADVLRKQVWNANISGVMWDFGEYTPITPDTKLANIS
SDAYFYHNQYPRDWAIFQRSVAKEMPLFDEMVTFHRSASLGSNRHLNLFWVGDQTTVWGV
NDGIKSAVTIMGQMGISGYAQSHSDLGGYTTAFHPPTVANSSGAIGRSAEILGRWGELAA
VSSAVFRSHEGNVPEVNAQFYTNSSTYSYYAYNARMFKSLGPYRRQVLNNESKTRGWPLL
RMPVLYHPDDSKARHISYQSFYLGADLYVAPVLDPQTTKLNVYLPGTDRNRTYTHVWTGQ
TYHAGQTVRVDAPYGKPAVFVVNHAHSPELNVFLDFVRKENGTVIRV

Enzyme Prediction     

No EC number prediction in AO090701000558-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	267	741	2.8e-67	0.9789227166276346

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236691	PRK10426	6.53e-169	126	741	51	617	alpha-glucosidase; Provisional
269880	GH31_glucosidase_YihQ	1.05e-143	285	634	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
224418	YicI	1.56e-54	212	741	183	664	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	3.71e-40	267	741	2	436	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	4.62e-32	305	706	16	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE62256.1|GH31	0.0	1	767	1	767
QMW32300.1|GH31	0.0	1	767	1	770
QRD83751.1|GH31	0.0	1	767	1	770
QMW44330.1|GH31	0.0	1	767	1	770
UDD57268.1|GH31	0.0	1	767	1	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AED_A	2.64e-90	154	740	115	661	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
5AEE_A	1.39e-89	154	740	115	661	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
6PNR_A	8.75e-85	129	762	75	666	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5OHY_A	1.15e-79	34	740	1	646	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHS_A	5.95e-79	34	740	1	646	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	1.13e-89	154	740	115	661	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
sp|B3PEE6|OL4AG_CELJU	7.64e-15	220	705	189	633	Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=agd31B PE=1 SV=1
sp|Q69ZQ1|MYORG_MOUSE	7.49e-13	356	705	365	680	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
sp|Q9F234|AGL2_BACTQ	1.39e-12	165	741	146	668	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|Q6NSJ0|MYORG_HUMAN	7.26e-10	352	705	362	678	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999743	CS pos: 22-23. Pr: 0.9634

TMHMM  Annotations     

There is no transmembrane helices in AO090701000558-T-p1.