CAZyme Information: AO090701000527-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090701000527-T-p1
• CAZy Family: GT4
• CAZyme Description: Has domain(s) with predicted flavin adenine dinucleotide binding, oxidoreductase activity, acting on CH-OH group of donors activity and role in oxidation-reduction process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514		54560.63	5.0492

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr5_A_oryzae_RIB40:960886-962539(-)

Full Sequence      

MEEADYVIVGGGTAALVVACRLSENPETRIVVLERGEDTSSDARVQDPLVYESLMGSEMD
WNLKGAPQAGLNGREFNQAAGKALGGSSVIDGCIFLPPAAAAFNAWESLGNPGWNWETLA
PCFQRAYTLHPRTGGPQSNTAGPIQVSYPVPTERADTTLLDAWKQAFEEHGYGYADELVS
EGATIGTRPYTATIDPVSGHRSSAANGYGAIIASRANVRIVTGASVTQVQIEAQGTVLFK
PTKEVIMAAGVFNNPQILELSGIGDPARLQTLGISPLVHLPGVGENLTNHAMSVLSAPVK
AHADIQDIAPGMKANAFIHLAPMDMQEILDRAREAPDHAAIAGILNGPNEASACIHFAIY
PGNLAIIGIFPSFPFSRGSVHIQSADPASSPQIDPKYLNHPSDLDSMVRHVQHLQEIFHS
ARLQPFVDAPPPQDREALAQLVREAMAIPTAHACGTTAMLPRERGGVVASDLKVYGVSNV
RVVDASVFPVISQANPISTVYTVAERAADLIRAN

Enzyme Prediction     

No EC number prediction in AO090701000527-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	513	2.1e-134	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.53e-85	1	514	5	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.49e-82	1	512	3	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	9.56e-37	374	507	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	6.53e-20	72	290	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.07e-19	5	500	57	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW44362.1|AA3_2	0.0	1	514	1	532
UDD57301.1|AA3_2	0.0	1	514	1	532
QRD83786.1|AA3_2	0.0	1	514	1	532
QMW32332.1|AA3_2	0.0	1	514	1	532
CAK96464.1|AA3_2	1.07e-148	3	512	5	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	6.95e-60	5	512	7	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	4.26e-48	6	512	8	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	7.17e-48	3	514	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	9.56e-47	3	514	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6O9N_A	7.13e-46	2	511	34	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	5.83e-65	2	514	45	618	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	5.83e-65	2	514	45	618	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A5C1RDA6|ASC9_DIDFA	3.28e-57	5	514	15	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A142PTM2|CITC_MONPU	2.33e-55	5	512	15	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	2.33e-55	5	512	15	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000006

TMHMM  Annotations     

There is no transmembrane helices in AO090701000527-T-p1.