CAZyme Information: AO090701000400-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090701000400-T-p1
• CAZy Family: GT39
• CAZyme Description: Ortholog(s) have inulinase activity, sucrose alpha-glucosidase activity, role in inulin catabolic process, raffinose catabolic process, sucrose catabolic process and extracellular region, fungal-type vacuole, mitochondrion localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525	Chr5_A_oryzae_RIB40|CGC29	57459.42	4.6235

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

Full Sequence      

MYIKPFILPALAAVAQAASYSGDLRPQTHFSPPSNFMNDPNGLFYDSKRGVYHLYYQYNP
TATVAGNQHWGHATSPDLYHWTNQPIALAGDKPEEYIFSGSAVVDSNNTSGFFPDQDDGV
IAIYTVDTPTLETQHIAYSRDGGYTFTKYENNPVIDIGSKQFRDPQVVWHPETQQWVMTI
AYAQDLVIGFYTSPNLKDWTHASNFTQEGLPGDQFECPNLVKLSVDRAVSEETSKFVLFI
SVNPGAPLGGSGTFYVVGDFNGTHFTSEVVQETLFDFSKDNYAAQWYSGIPENEPPVSIG
WASNWDYTEEVPTGPLEGWRSAMTLPRAHTLTKVNGVWTVTHSPFEGLSALKGRQLVSKS
VHSGDVKANFSGVPSNAVYFDVTLKGIDVAKPTGRVNFNFTSSVSGEFLDGGVSLDDSSF
WISRAGTHLFTIEDNGNYTSSSTTTISSFGNGTFSFSGVIDRSVFEVFLGQDGIQSGTMT
FFPSSPLDTLAVSAEDLGDRASVSVKAWGLQSGWNSTTASKRFRA

Enzyme Prediction     

EC	3.2.1.26:5	3.2.1.80:2	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	29	336	6e-92	0.9761092150170648

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
350134	GH32_Inu-like	8.86e-144	34	331	1	289	glycoside hydrolase family 32 protein such as Aspergillus ficuum endo-inulinase (Inu2). This subfamily of glycosyl hydrolase family GH32 includes endo-inulinase (inu2, EC 3.2.1.7), exo-inulinase (Inu1, EC 3.2.1.80), invertase (EC 3.2.1.26), and levan fructotransferase (LftA, EC 4.2.2.16), among others. These enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
214757	Glyco_32	5.86e-107	29	473	1	437	Glycosyl hydrolases family 32.
224536	SacC	5.56e-101	20	512	24	486	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
395193	Glyco_hydro_32N	1.16e-90	29	336	1	302	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
350110	GH32_FFase	4.02e-74	35	331	1	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE62112.1|GH32|2.4.1.-	BAE62112.1|GH32|2.4.1.-	0.0	1	525	1	525
ALZ45077.1|GH32	ALZ45077.1|GH32	0.0	1	525	1	525
ACZ48670.1|GH32	ACZ48670.1|GH32	0.0	1	525	1	525
ADD37833.1|GH32	ADD37833.1|GH32	0.0	1	525	1	525
QRD83923.1|GH32	QRD83923.1|GH32	0.0	1	525	1	525

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3KF3_A	3KF3_A	5.60e-105	25	482	10	476	Chain A, Invertase [Schwanniomyces occidentalis],3KF3_B Chain B, Invertase [Schwanniomyces occidentalis]
3KF5_A	3KF5_A	6.12e-105	25	482	13	479	Chain A, Invertase [Schwanniomyces occidentalis],3KF5_B Chain B, Invertase [Schwanniomyces occidentalis]
3U75_A	3U75_A	9.32e-104	25	482	36	502	Chain A, Fructofuranosidase [Schwanniomyces occidentalis],3U75_B Chain B, Fructofuranosidase [Schwanniomyces occidentalis],3U75_C Chain C, Fructofuranosidase [Schwanniomyces occidentalis],3U75_D Chain D, Fructofuranosidase [Schwanniomyces occidentalis]
6J0T_A	6J0T_A	1.20e-103	25	485	39	527	The crystal structure of exoinulinase INU1 [Kluyveromyces marxianus DMKU3-1042],6J0T_B The crystal structure of exoinulinase INU1 [Kluyveromyces marxianus DMKU3-1042]
3U14_A	3U14_A	1.85e-103	25	482	36	502	Chain A, Fructofuranosidase [Schwanniomyces occidentalis],3U14_B Chain B, Fructofuranosidase [Schwanniomyces occidentalis],6S1T_A Chain A, Fructofuranosidase [Schwanniomyces occidentalis],6S1T_B Chain B, Fructofuranosidase [Schwanniomyces occidentalis],6S2B_A Chain A, Fructofuranosidase [Schwanniomyces occidentalis],6S2B_B Chain B, Fructofuranosidase [Schwanniomyces occidentalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5DHM6|INUE_PICGU	sp|A5DHM6|INUE_PICGU	3.82e-106	25	482	20	479	Extracellular exo-inulinase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) OX=294746 GN=PGUG_02777 PE=1 SV=2
sp|A8W7I5|INUE_PICGM	sp|A8W7I5|INUE_PICGM	5.98e-105	25	482	20	479	Extracellular exo-inulinase inuE OS=Meyerozyma guilliermondii OX=4929 PE=1 SV=3
sp|P28999|INU1_KLUMA	sp|P28999|INU1_KLUMA	3.01e-103	25	485	39	526	Inulinase OS=Kluyveromyces marxianus OX=4911 GN=INU1 PE=1 SV=1
sp|P00724|INV2_YEAST	sp|P00724|INV2_YEAST	3.81e-101	6	482	8	501	Invertase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUC2 PE=1 SV=1
sp|P10596|INV4_YEASX	sp|P10596|INV4_YEASX	1.07e-100	6	482	8	501	Invertase 4 OS=Saccharomyces cerevisiae OX=4932 GN=SUC4 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000238	0.999739	CS pos: 17-18. Pr: 0.9747

TMHMM  Annotations     

There is no transmembrane helices in AO090701000400-T-p1.