CAZyme Information: AO090701000391-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090701000391-T-p1
• CAZy Family: GT39
• CAZyme Description: Has domain(s) with predicted flavin adenine dinucleotide binding, oxidoreductase activity, acting on CH-OH group of donors activity and role in oxidation-reduction process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
892	Chr5_A_oryzae_RIB40|CGC5	95911.00	6.0751

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr5_A_oryzae_RIB40:1307522-1313045(-)

Full Sequence      

MTKALLIGAWPNGDSVVSSLREAQSYTNPDVYSGDASLEEIPDGTSINSTHLTYTFLCRG
CVVGTPTTFGKDMDSYFFGWALSKTSPKSPASSDATLNYHAAGFGSFQMVLSDAKSAKYS
TWASKAKASSTTTPSASASASPSSTPSASAAPTVLNSTYDYIVVGGGPAGIITAERLAET
KKKVLLLERGVAPTVQMGNKNALSWNNSLTPHDVPALGSSLSKLGLLDDYLCDDTAGMAG
CVLGGGTIVNALAFIYPQEADFNDKWPAGWKWDDVKEAASRLYERNPGSILPSADGKRYD
YGMYDVLGGFFKGLGWKSVNQHEQPNEKHQAYGYPSWSVANGIRAGPVRSYLPLAQELDN
FSLRLQTKVRRLVRRGGRITGVEVETESGAIEIINIRAGGKVVLAAGSMSTPRVLFNSGI
GPAKQIENVKSGSTGITVPAQEEWINLPVGENLKDHPMFTISVHTKSNFTAFNTSSVLSG
PAAAVQQLYSKGSAKRKFCSASKMLTPPSISRSSPVTSPGPYLSYPSGLGVNLDEVMRNW
DELPPERKKAGDRWSAVINPDIDKNWEIDLLHSVTHDSIVNCVQFSNDGKYIAVGCADGA
VQIVEVSTGTQVARLQDEGYSHDCLCVRVRFLPDNYLLLTAHSDGNIRVWNYMGSLLRRI
PCGSETGFFTLDLSATGHLIAFSERNKTVKAWDLDAASGIRQLGTLHTADDVYIVAVSPD
SGYIAAGCDDGMIYIWRADSLDPGTASASGTKIEKVLEFQAHDENVMALSFTPDCRSIIS
GGMDGTAKLWNIDSLKAFVNEDITPNDCTLIYKAHQDMVLSVSPDPTGNWLLSGSKDMTV
YLWDISTGVAEMRLGAHGNSVLGIAWSPTDNIVATGGGDRVLQLWRLHRISQ

Enzyme Prediction     

EC	1.1.99.18:13	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	148	491	4.3e-136	0.6277372262773723
AA8	1	122	1.4e-34	0.6758241758241759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238121	WD40	7.09e-59	576	886	8	289	WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.
293791	7WD40	6.52e-44	582	885	3	293	WD40 repeats in seven bladed beta propellers. The WD40 repeat is found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing, and cytoskeleton assembly. It typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40. Between the GH and WD dipeptides lies a conserved core. It forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel beta-sheet. The WD40 sequence repeat originally described in literature forms the first three strands of one blade and the last strand in the next blade. The C-terminal WD40 repeat completes the blade structure of the N-terminal WD40 repeat to create the closed ring propeller-structure. The residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands, allowing them to bind either stably or reversibly.
406418	CDH-cyt	1.74e-39	1	118	59	177	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
225201	WD40	1.86e-37	575	888	153	442	WD40 repeat [General function prediction only].
225201	WD40	3.33e-33	564	892	52	363	WD40 repeat [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW44486.1|AA3_1|AA8	0.0	1	493	84	576
QRD83935.1|AA3_1|AA8	0.0	1	493	84	576
QMW32457.1|AA3_1|AA8	0.0	1	493	84	576
UDD57457.1|AA3_1|AA8	0.0	1	493	84	576
GAA91858.1|AA3_1|AA8	1.89e-235	1	493	86	582

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	3.15e-87	1	492	74	565	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI6_A	3.88e-83	1	456	74	531	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1KDG_A	3.04e-64	152	481	1	333	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI4_A	7.03e-64	152	456	1	309	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1NAA_A	1.24e-62	159	481	3	328	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	1.39e-81	1	481	83	560	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q9VY01|EO_DROME	1.78e-20	158	485	89	404	Ecdysone oxidase OS=Drosophila melanogaster OX=7227 GN=Eo PE=1 SV=2
sp|Q2KB43|BETA_RHIEC	6.45e-20	160	459	4	294	Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) OX=347834 GN=betA PE=3 SV=1
sp|Q1MJU4|BETA_RHIL3	1.50e-19	160	459	4	294	Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) OX=216596 GN=betA PE=3 SV=1
sp|C3MIE4|BETA_SINFN	3.50e-19	160	459	4	294	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000004	0.000048

TMHMM  Annotations     

There is no transmembrane helices in AO090701000391-T-p1.