CAZyme Information: AO090701000321-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090701000321-T-p1
• CAZy Family: GT33
• CAZyme Description: Ortholog(s) have fibrinogen binding, pectate lyase activity and role in pectin catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	Chr5_A_oryzae_RIB40|CGC26	34121.51	4.5570

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr5_A_oryzae_RIB40:1498485-1499688(-)

Full Sequence      

MANFKLFLALAACLSGQALAAPTKTIGKRAAITDVAHGYASQNGGTTGGAGGTTTTVSSY
AQFTEAVSSDDAKIVIVDGTITETADQVKVGSNTSIIGKDANAILEGFGLLVKEKENVII
RNLGVKKVLADNGDAIGVQYSNNVWIDHCDVSSDRDHDKDYYDGLIDLTHAADYVTVSNT
FVHDHWKAMLFGHSDSNGDEDTGHLRITVNNNYLNNLNSRGPSFRFGTGHLYNNYYLDVS
DGINTRQGAQLLVEGNVWSGGKKPLYSTDDGYAVARDNDFGDGENTAPEGTLTSVPYEYD
LLAASAVKDAVVGTAGQTLTF

Enzyme Prediction     

EC	4.2.2.2:30

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	76	258	4.4e-88	0.994475138121547

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.61e-57	84	257	8	185	Amb_all domain.
226384	PelB	1.35e-46	73	316	77	340	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	9.49e-35	86	258	28	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD84013.1|PL1_7	7.68e-223	1	321	1	321
BAE62049.1|PL1_7	7.68e-223	1	321	1	321
QMW32517.1|PL1_7	7.68e-223	1	321	1	321
QMW44547.1|PL1_7	7.68e-223	1	321	1	321
UDD57526.1|PL1_7	7.68e-223	1	321	1	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	3.71e-41	38	316	6	321	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	1.75e-30	33	243	4	254	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
1OOC_A	3.59e-28	38	256	16	285	Chain A, Pectate lyase A [Dickeya chrysanthemi],1OOC_B Chain B, Pectate lyase A [Dickeya chrysanthemi],1PE9_A Chain A, Pectate lyase A [Dickeya chrysanthemi],1PE9_B Chain B, Pectate lyase A [Dickeya chrysanthemi]
1JRG_A	3.35e-26	38	256	16	285	Chain A, Pectate lyase [Dickeya chrysanthemi],1JRG_B Chain B, Pectate lyase [Dickeya chrysanthemi],1JTA_A Chain A, pectate lyase A [Dickeya chrysanthemi]
1VBL_A	2.35e-25	88	236	128	301	Structure of the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8R6|PLYA_ASPOR	1.36e-223	1	321	1	321	Probable pectate lyase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyA PE=3 SV=1
sp|B8NE46|PLYA_ASPFN	1.36e-223	1	321	1	321	Probable pectate lyase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyA PE=3 SV=1
sp|A2QV36|PLYA_ASPNC	6.40e-172	1	321	1	323	Probable pectate lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=plyA PE=3 SV=1
sp|Q9C2Z0|PLYA_ASPNG	7.44e-171	1	321	1	323	Pectate lyase A OS=Aspergillus niger OX=5061 GN=plyA PE=1 SV=1
sp|B0XT32|PLYA_ASPFC	2.17e-153	10	321	7	321	Probable pectate lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999751	CS pos: 29-30. Pr: 0.4720

TMHMM  Annotations     

There is no transmembrane helices in AO090701000321-T-p1.