CAZyme Information: AO090701000186-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090701000186-T-p1
• CAZy Family: GT32
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN8444/celA, A. fumigatus Af293 : Afu3g03620, Afu8g00680, A. niger CBS 513.88 : An03g05740, A. oryzae RIB40 : AO090138000033 and Aspergillus wentii : Aspwe1_0040565

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
703	Chr5_A_oryzae_RIB40|CGC27	79090.54	6.6362

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr5_A_oryzae_RIB40:1847405-1849648(-)

Full Sequence      

MVDQHEGQQDQEKIAALNIYETEHNTNSFECQEEYAKGMIPIRPKHLSFESSDTAKDSSP
SLCKEAQVDESPSSPTGSSNIAVLHNRDDVDISTGWRRWVFTLAPLFTIINTAVYFFYLG
LRIYCIVMAQRSVDIYYGGAWIFVAVEMAVAIPSMIHNLWTVMAWKKRSRPKLRLTGDKV
PTVDVFVTCCGEDDVVILDTVRGACDQDYPQDKFRVIVLDDAKSASLAAAVKELATMYPN
IFYMAREKIPGKPHHFKAGNLNYGLEQVQYLPGGANELMAALDADMIPEREWLRAVLPHL
LVDAKVALACPPQLFYNTPASDPLGQSLDFFVHIIEPIKDALGVAWCTGSGYIVRREALA
DIGNFPLGTLTEDVATSTLMLGKGWKTVYIHEPLQFGSVPEDYGGHLKQRTRWAIGTVDT
AAKLNFCLWGKNIQHLTFAQRFSGFIYAILNLFTLLLTASLFTIPIILLWGKPLVAYAND
DQLHWLIWACFASTIINRLCEATLFSPAGYHTGQRNSRFQLWMAPYIAVCMVRSFILPKW
LGGQTQAFKPTGSLASALNERDPKLTKNMFVRLRVMLLNYMVFFHLAFVYVTLIAVIVSS
YRCFAIENGARDVIVCLITHAFWPPFAFFFICSSMWTPIAYAINPPIMPDREDLLVRDQK
TGVAHPTEESKRIAFGGQAVWFEFEYSAATIATVLVFAYSFFF

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	182	415	1.8e-21	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	1.47e-105	181	421	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	4.89e-43	128	470	1	334	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	2.23e-27	181	441	260	508	cellulose synthase catalytic subunit; Provisional
133045	CESA_like	1.84e-25	185	373	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133057	CESA_NdvC_like	2.74e-23	187	418	4	229	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW44668.1|GT2	0.0	1	703	1	703
QMW32638.1|GT2	0.0	1	703	1	703
QRD84146.1|GT2	0.0	1	703	1	703
BAE61927.1|GT2	0.0	1	703	1	703
UDD57661.1|GT2	0.0	1	703	1	703

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	3.56e-23	181	441	273	521	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	4.64e-22	175	416	122	374	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	5.21e-22	175	416	134	386	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	5.22e-22	175	416	135	387	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
6YV7_B	1.20e-08	160	423	27	270	Mannosyltransferase PcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O82859|BCSA2_KOMSB	6.85e-29	178	449	146	413	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|Q9RBJ2|BCSA4_KOMXY	1.01e-28	163	449	127	408	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
sp|Q9WX75|BCSA5_KOMXY	1.01e-28	163	449	127	408	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
sp|P19449|BCSA1_KOMXY	1.20e-28	178	449	146	411	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|P0CW87|ACSA1_KOMXY	1.26e-27	151	449	119	411	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

Start	End
99	121
142	164
448	470
483	505
520	537
576	598
613	632
680	702