CAZyme Information: AO090166000063-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090166000063-T-p1
• CAZy Family: PL1
• CAZyme Description: Has domain(s) with predicted role in biosynthetic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1271		140036.29	6.4588

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr4_A_oryzae_RIB40:4729823-4733638(+)

Full Sequence      

MATLGEVVDTILGQRVQLRRLQGSGAAGQSGCSIYFARPCDEDDNDTEDKTKRPIAVVKV
YPPHRHSDLLDELASYKTLRSLPSPPRAVHPIGVGRTRDEESGALAGVVVYQVATGKAVN
TILCELGWITRLRSLVRDAAMDVTNRHKLQIFMEQNRGDIPVDWEAHKALEKQGVDIYFS
EALPAFFEQRYQHLLRDLRSAMRAVASVLAKLHTGRRGEWCDAAENALENIRKRIRGWIE
EIQTDAAPGYDNAGIGVDRREEMQDMVEYAIHQAKHRATTSLTHGDASSGNFFWDSNIGV
TMIDYGGVRLSTDESGKPTGLAEMDTAGFYERLRKYAPSFGVSDDDVTSLQETFWTAYHE
HNMSLDPDIVRLVRLRIQMSRLWSAVDKFNQSQDGNQAVVEGEFQRLRSIAKLLRDQGAW
KRNILVVSNASGCGKGGIPFLNQELVNGLAGLNGVSVALFLVGDNNSVSQTHHENVTVVG
LPGSEANGELLYYMAKVHQPEEFGLPTHRDANCRSPFDLIIGHSRYSSAAAALVRDRFYP
AAKLALITHTSPLRKADAAWAWYGGSRQQGYEEATRLAMLDERILPKADLAVGVGPVLTN
EAREREWVGQLTRPRWSLTGPRFHELIPGAHIVKDDKDIRARRPDDPFKVLLAGRADDPA
KGVDDAIHAVWKLAESGVENITIDILGVPIGEVEKRQEEVDQMTGIPALVRFHPFSNDQH
VVRRSYQAADLVVMPSTHEGFGMIFTEVAGLGIPILVTEDSGAGQFALDRSRIPAELGDA
VVVMDEKAYGIPASIKSSRVGLWADRINQVRQNPIQAVRNARELHNVMRGYSWAHAAEAL
LDAAMEHHEGDTVQTAHGSLLPYRPLLSPEVDASLRCATTIRNHNGVPEREQAAAVVKSL
PEIAPSLNALNEFVSKALGHQVILRPLDGPHVKGFSGAPVFFAHSTFTHSYQTRQTDAAI
LSQGEELAVIKLFPAGLDNGIAEELSSLEWLLHQTKGDINTPTPIAVGRTTWDEKETGVV
TYRVAQGVSLYQLMARLGLLDGPERDDSVTVLKRGVIEAAKTLAKLHSYAVQGRSSEGYL
EWYYDAAPGRVNRLRSHAGILLEHTGIDVDKLDEKVHTLIAQSRQEIYRHPQAAVVHGDA
HPGNFFFDPRSGRTTVIDVTTLHCSLDENGNPAGTPERDVGHFLHMLRRTGEQLNMREKE
MDECSRAFLTAYKGTAAGKLGIHTLRLLGVCSALSFVGHALQGPSIDGQILKQQAKILDD
MFCLDQSGLLG

Enzyme Prediction     

No EC number prediction in AO090166000063-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340831	GT4_PimA-like	1.09e-21	423	842	1	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
223515	RfaB	1.80e-14	422	842	1	372	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
395425	Glycos_transf_1	2.75e-14	646	823	1	157	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
340830	GT4_sucrose_synthase	3.66e-13	472	842	58	398	sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.
404563	Glyco_trans_1_4	4.55e-11	647	758	1	103	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE61714.1|GT4	0.0	1	1271	1	1271
QMW31956.1|GT4	0.0	1	1271	37	1307
QRD91027.1|GT4	0.0	1	1271	37	1307
UDD60927.1|GT4	0.0	302	1271	1	970
QQK42333.1|GT4	0.0	7	1266	45	1289

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KIH_A	7.62e-07	563	820	168	409	Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_B Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_C Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_E Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_F Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_G Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_H Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_I Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_J Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_K Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_L Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1SP12|MSHA_NOCSJ	5.48e-10	436	842	60	445	D-inositol 3-phosphate glycosyltransferase OS=Nocardioides sp. (strain ATCC BAA-499 / JS614) OX=196162 GN=mshA PE=3 SV=1
sp|Q5YP47|MSHA_NOCFA	3.77e-09	480	862	87	434	D-inositol 3-phosphate glycosyltransferase OS=Nocardia farcinica (strain IFM 10152) OX=247156 GN=mshA PE=3 SV=1
sp|D5UJ42|MSHA_CELFN	6.42e-09	517	841	138	433	D-inositol 3-phosphate glycosyltransferase OS=Cellulomonas flavigena (strain ATCC 482 / DSM 20109 / BCRC 11376 / JCM 18109 / NBRC 3775 / NCIMB 8073 / NRS 134) OX=446466 GN=mshA PE=3 SV=1
sp|D1A4Q3|MSHA_THECD	1.08e-08	583	862	160	430	D-inositol 3-phosphate glycosyltransferase OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) OX=471852 GN=mshA PE=3 SV=1
sp|A0QQZ8|MSHA_MYCS2	7.67e-08	517	841	114	400	D-inositol 3-phosphate glycosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=mshA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AO090166000063-T-p1.