CAZyme Information: AO090138000087-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090138000087-T-p1
• CAZy Family: GT25
• CAZyme Description: Has domain(s) with predicted catalytic activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453		51364.13	6.6147

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr6_A_oryzae_RIB40:4014749-4016372(+)

Full Sequence      

MGKWNKSKLWNVASKALNNAIPPTLCPEYTGADGVTYVYRTLDFWTSGFFPGSLYLLLER
QTLYPGFYDIPWRVNKKSPLPHKLQLQHLCQWWTANLHANAAKRDTHDLGFMIAPWAMKA
WSLNRDPQAYNSLVLAAHSLASRFDERVQSLRSWDVCHTKRYSFTDPEKDFLVIIDNMLN
LDLLFWVAKETGNAKFHDIAVAHARTTAKHHIRSDNSTVHVVNYDTDTGLPKSKFTHQGY
SDESCWARGQAWGILGFMQTFEWTGEMEFLTTARSLADYFIRRLPDDGVPYWDFDAPVDS
SCPRDTSAGMVAGCGMLLIYKALRGVDEDAAEFYLKSAVRILAGTMNGFMTPGDLRFEVG
ESDTVVPTYPDDLPEHERRQSGALRVTDSRLTQNGNGTSKNTPETIIDGATINNYEFATR
RWANHGLVYADYYFMLMGNMLLELGLVSGTRLL

Enzyme Prediction     

No EC number prediction in AO090138000087-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	42	347	6.5e-97	0.8449848024316109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	3.96e-09	178	313	132	263	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE64465.1|GH88	0.0	1	453	1	453
QMW38998.1|GH88	0.0	7	451	53	497
QMW26918.1|GH88	0.0	7	451	53	497
QRD81239.1|GH88	0.0	7	451	53	497
UDD54722.1|GH88	0.0	7	451	53	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZZR_A	6.00e-48	28	333	49	331	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	6.14e-48	28	333	50	332	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	3.23e-47	28	333	50	332	Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	3.23e-47	28	333	50	332	Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]
3WUX_A	3.23e-47	28	333	50	332	Crystal structure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	8.75e-56	45	348	77	359	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q8E372|UCDH_STRA3	3.16e-47	28	333	50	332	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	8.37e-46	38	353	58	353	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	1.24e-45	105	333	113	333	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
sp|Q9RC92|UGL_BACGL	1.11e-43	37	372	34	348	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000079	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AO090138000087-T-p1.