CAZyme Information: AO090138000033-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090138000033-T-p1
• CAZy Family: GT25
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN8444/celA, A. fumigatus Af293 : Afu3g03620, Afu8g00680, A. niger CBS 513.88 : An03g05740, A. oryzae RIB40 : AO090701000186 and Aspergillus wentii : Aspwe1_0040565

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	Chr6_A_oryzae_RIB40|CGC14	64154.13	9.0517

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr6_A_oryzae_RIB40:4128161-4130030(+)

Full Sequence      

MISEYVGEIEELPPDPRIWSGKRYRKYLYHTAQAAIWTSTVYYPIRLLMILLEAQQSWPM
WLMLAVEAIFGRLSYQDQRLTVAAGGEPERGPRKRLRLRGSHNLPRVDVLIPCCGEPVSV
ILDTVRAACTMDYPESQLRVLVLDDGASTQLRDAVSELHSKWPYLFYHTRGRQSGRVFAK
AGNLNYALFTVQKDTPPEFCAILDADSIPKPDFLRATLPHLLLSPQTALVTTRQYFDNLP
AGDPLSQSRLHFYTCQNAELDRCGRAIDAGSGAVFRRNAIIDVGGYPTFSFSEDWQLSLI
LRGMGYRTVQVQEPLQFGLVPTSLEGHIAQRNRWHIGHSQQLFTLRPLTSSSIPRHLQWS
IACGGLAITLGLVGHVIGYGAVPWLLMSRSLIPASSSFLIKTQVILGLLHVSTMWAYGWL
QTAHAGIRGSPFSQLENSWLAGAHLSAVIRFHFISSAPKGSFVTGSKENSWNRITKSSFY
KMLYQDLWQNGILQSICLLLATIAAMLLSTWTTLTTTDSELLTTRLLTTIAWPPLLHICY
LTVTNHWVPVAYLLSPPVYPARASQMAVLGSKE

Enzyme Prediction     

No EC number prediction in AO090138000033-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	105	335	1.1e-21	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	8.14e-102	105	342	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	5.64e-39	36	483	2	431	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	1.95e-25	105	349	260	499	cellulose synthase catalytic subunit; Provisional
133059	CESA_CaSu_A2	2.24e-23	105	337	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
133057	CESA_NdvC_like	6.97e-22	111	342	4	232	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD81189.1|GT2	0.0	1	573	1	573
UDD54668.1|GT2	0.0	1	572	1	572
BAE64416.1|GT2	0.0	1	445	1	445
QMW26873.1|GT2	0.0	1	445	1	445
QMW38953.1|GT2	0.0	1	445	1	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.18e-26	102	348	125	385	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.33e-26	102	348	137	397	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.34e-26	102	348	138	398	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	1.02e-23	105	353	273	516	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
6YV7_B	6.07e-06	105	342	42	264	Mannosyltransferase PcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P58931|BCSA_PSEFS	1.98e-27	105	412	159	460	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
sp|P58932|BCSA_XANAC	6.14e-27	93	340	140	383	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
sp|Q9WX75|BCSA5_KOMXY	2.42e-25	105	353	146	389	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
sp|Q9RBJ2|BCSA4_KOMXY	2.42e-25	105	353	146	389	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
sp|P37653|BCSA_ECOLI	5.17e-23	105	353	273	516	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000010

TMHMM  Annotations     

Start	End
364	386
398	420
492	514
526	548