CAZyme Information: AO090124000048-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090124000048-T-p1
• CAZy Family: GT22
• CAZyme Description: Ortholog of A. fumigatus Af293 : Afu3g03950, Aspergillus flavus NRRL 3357 : AFL2T_07998, Neosartorya fischeri NRRL 181 : NFIA_006240 and Aspergillus wentii : Aspwe1_0111693

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
255	Chr5_A_oryzae_RIB40|CGC26	27470.69	7.1975

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr5_A_oryzae_RIB40:2569489-2570312(+)

Full Sequence      

MAYRTAIDSVLSATSSIHHHTNAATAVVYNKLARTAMHFNSVFSVLLSCGLAAAHMQMSW
PYPIRSPLDPQNRGSDKDYDMANPLSPSGSDFPCKGYHKNTPWRATAEYNAGESYNMTVA
GAATHSGGSCQLSLSYDDGKTFKVIKSKVGGCPLDFKYDFTMPSDVVNGHALFAWSWFNL
VGNREMYMNCANVEVSGGSGSKQSFENNYPDMFVANVGNGCSTVEGKHTVFAHPGKQVTY
AGGLDASSPPFPNCS

Enzyme Prediction     

No EC number prediction in AO090124000048-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	55	242	1.2e-66	0.9738219895287958

CDD Domains     

AO090124000048-T-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE62598.1|AA11	3.33e-193	1	255	1	255
QRD84377.1|AA11	2.74e-192	1	255	1	255
UDD57916.1|AA11	2.74e-192	1	255	1	255
QMW44880.1|AA11	8.67e-167	37	255	1	219
QMW32850.1|AA11	8.67e-167	37	255	1	219

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	1.72e-36	55	242	1	203	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

AO090124000048-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.983108	0.016881

TMHMM  Annotations     

There is no transmembrane helices in AO090124000048-T-p1.