CAZyme Information: AO090124000009-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090124000009-T-p1
• CAZy Family: GT21
• CAZyme Description: Has domain(s) with predicted polygalacturonase activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432	Chr5_A_oryzae_RIB40|CGC1	45954.71	4.0118

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr5_A_oryzae_RIB40:2661919-2663454(+)

Full Sequence      

MQSKTFSVLSSCLLLIATVQGQLSGSVGPSTSISDKKAVKTCNVLDYGATNDNKTDVGQP
IMNAFEDCGSGGVIYIPEGDYLIQEWVSLRNGTAFAIQLDGVIYRNGTTTSQGYMFGISG
GSDFELYSSTSKGAIQGSGYLYHMNGEFTAPRLLHISDVSHWSVHDIALVDAPMFHFVID
DASNGEVYNMAIRGGNSGGLDGIDVSGDNIWIHDVMVTNKDECVTVKTGSHNFQIENIYC
NWSGGCAMDSLGSGTNVSNIVYRNIYTWNSNQMYMIKSNGGDGEVSNLLFENFIGHGNAY
SLDLDSEWSSMDTVDGDDGESRPPIRVICPEAIPCTDITIEDVDLWTEEGDSETYVCKNA
FGSGACLKSDSSSTATYATTTTVTSAPSGYSATTMAADLTSAFGTDASIPIPTIPTSFYP
GATPYSALAGSS

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	67	360	1e-45	0.9569230769230769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215540	PLN03010	2.16e-18	43	365	48	394	polygalacturonase
395231	Glyco_hydro_28	7.15e-15	149	366	83	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	3.76e-14	37	360	63	418	polygalacturonase ADPG
215426	PLN02793	1.77e-11	5	363	14	412	Probable polygalacturonase
215120	PLN02188	8.78e-11	13	360	9	390	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE62561.1|GH28	0.0	1	432	1	432
QMW44915.1|GH28	4.22e-310	1	432	1	449
QMW32887.1|GH28	6.99e-309	1	432	1	449
QRD84419.1|GH28	8.45e-309	1	432	6	454
UDD57956.1|GH28	8.45e-309	1	432	6	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	6.59e-197	22	430	1	422	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
1K5C_A	6.67e-07	201	263	153	214	Endopolygalacturonase I from Stereum purpureum at 0.96 A resolution [Chondrostereum purpureum],1KCC_A Endopolygalacturonase I from Stereum purpureum complexed with a galacturonate at 1.00 A resolution. [Chondrostereum purpureum],1KCD_A Endopolygalacturonase I from Stereum purpureum complexed with two galacturonate at 1.15 A resolution. [Chondrostereum purpureum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U7A4|RHGE_ASPOR	0.0	1	432	1	432	Probable rhamnogalacturonase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgE PE=3 SV=1
sp|B8NKB9|RHGE_ASPFN	1.24e-309	1	432	1	449	Probable rhamnogalacturonase E OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgE PE=3 SV=2
sp|Q1ZZM3|RHGE_ASPNG	1.88e-221	15	432	16	450	Probable rhamnogalacturonase E OS=Aspergillus niger OX=5061 GN=rhgE PE=3 SV=1
sp|Q00001|RHGA_ASPAC	9.69e-198	17	430	14	440	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1
sp|Q5ARE6|RHGA_EMENI	1.69e-195	10	432	4	442	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999778	CS pos: 21-22. Pr: 0.9792

TMHMM  Annotations     

There is no transmembrane helices in AO090124000009-T-p1.