CAZyme Information: AO090120000309-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090120000309-T-p1
• CAZy Family: GT2
• CAZyme Description: Has domain(s) with predicted flavin adenine dinucleotide binding, oxidoreductase activity, acting on CH-OH group of donors activity and role in oxidation-reduction process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646	Chr5_A_oryzae_RIB40|CGC17	70253.30	4.5881

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr5_A_oryzae_RIB40:3494740-3496680(-)

Full Sequence      

MFVRQLLGLLAVGTGLTTAVNLTGYEYVVVGSGAGGGPLAARLALAGHKTLLIEAGDDQG
LNLNYSIPAYSAKASEDEEMSWNFFVRHYADEERQARDYKTSYETPDGEIYTGLNPPEGS
TMKGTLYPRTGTLGGCTAHNALIAIYPHQSDFEYIATLTGDGSWSPDNMRKYFAKLENNN
YLLPGQKGHGYDGWLHTETAPLSLVLEDPQLLSLLLGGAFALGNHTNTIFNVGTLLAGDA
NADKKTRDTKPGYYQIPISTNDAHRNGPREFILAVRDAKNDDGSKKYPLDVRTNCFVTKV
TFDESENPPRATGVEFLDGQHLYRASPLANDYSKGTPGTAQASREVIVAGGVYNSPQLLK
LSGVGPAEELQKFGIKVISDLPGVGTNLQDHYEITVQGHVPKDWAVLDGCTFSENGEADP
CIDRWETPTPILKDRGIYSSSGLAATMFYKSSVTADDSYDVFVFGGPVNFRGYFPNYSIN
ATSEHDWFTWAILKGHPRNSAGSVTLRSADPLDMPDIVFNYFDTGVGDYDADLQALYEAV
ELSREAFDRQLVEVTEVLPGADVKTKEDIQQYAKDTAWGHHASCTCPIGADDDPMAVLDA
KFRVRGVSGLRVVDASVYPKIPGTFTAVSTYIVAEKAADEILSELN

Enzyme Prediction     

No EC number prediction in AO090120000309-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	24	643	1.6e-97	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.10e-69	39	642	20	532	choline dehydrogenase; Validated
225186	BetA	1.62e-63	33	644	16	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.77e-35	499	637	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.46e-18	297	624	243	559	Protein HOTHEAD
366272	GMC_oxred_N	5.22e-14	125	393	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW33146.1|AA3	0.0	1	646	1	646
QRD84722.1|AA3	0.0	1	646	1	646
QMW45179.1|AA3	0.0	1	646	1	646
UDD58256.1|AA3	0.0	1	646	1	646
EAA61171.1|AA3	0.0	1	645	1	643

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	8.98e-43	25	638	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	1.22e-42	25	638	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.22e-42	25	638	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	1.22e-42	25	638	8	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	1.50e-42	25	638	24	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7FKL6|BETA_YERP3	1.56e-48	25	641	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=betA PE=3 SV=1
sp|B1JSR0|BETA_YERPY	1.56e-48	25	641	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=betA PE=3 SV=1
sp|Q1C932|BETA_YERPA	2.14e-48	25	641	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=betA PE=3 SV=1
sp|Q1CFR7|BETA_YERPN	2.14e-48	25	641	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=betA PE=3 SV=1
sp|Q8ZGW0|BETA_YERPE	2.14e-48	25	641	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis OX=632 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.072617	0.927353	CS pos: 19-20. Pr: 0.8766

TMHMM  Annotations     

There is no transmembrane helices in AO090120000309-T-p1.