CAZyme Information: AO090113000057-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090113000057-T-p1
• CAZy Family: GT1
• CAZyme Description: Ortholog(s) have carbon-oxygen lyase activity, acting on polysaccharides activity and role in pectin catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
695	Chr5_A_oryzae_RIB40|CGC30	77249.44	5.5324

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr5_A_oryzae_RIB40:4181814-4184138(-)

Full Sequence      

MFLPSRKALAFLACLASHSVALLTTSENSTHFNLANDRFSIALAKSNGHIVDVQLDGQDL
LGPVDGNAGKGPYLDCSCIPSGFWTPGSGAHLELINGTDSTGTAYGGLYMSATYAGTNQT
LSQWFFLRGEETGLHAFSRVTYFNETTPSLRSLGELRTLFRPSTDLWTHFSTSDGNYGPK
PLGSNSGLVVQDATTYIGNVTDDPYVSQYSDYFTKYTLAESWRNHDVHGLFSDGSSSSDG
STFGAWLVHNTVETYYGGPLHSDLVVDGIVYNYLVSGHHGAPTPNLTHGFDRTWGPQFYY
FNRGDSETTLADLRADAAKYADPEWNAEFYDSIADHIPNFTPSTGRTTFKGKVSLPKGAK
RPIIVLSEDGQDFQLNVFNTESLQYWAEIDKSGSFSIPRVVEGTYRITIYADEIFGWFIQ
DHVKVLKSQSKDYSFTWKEESAGKEIWRIGIPDKSSGEYLHGYAPDTSKPLQPEQHRIYW
GKYDYPADFPEGINFHVGKSDPSQDLNYIHWAFFPSQGNHLRTEPYYDNVNNWTVTFDLT
ADQLHNTNTATFTVQIAGAKTANGNAKWTPVEGKYSNLPWTVNVNGRYESTWVIPYWRSG
SCGVRSAVSCQNIEQKFAFPSKNLQEGKNEFVLSLPFNASSTETALLPDALYVQARVMGS
RLDPARPAPNPLVNSNLGFGRDNPIMEFSNNRIIT

Enzyme Prediction     

EC	4.2.2.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	21	648	0	0.9968354430379747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199907	RGL4_N	1.79e-57	26	310	4	265	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199904	RGL4_M	4.88e-31	345	425	1	81	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199905	RGL4_C	4.29e-23	447	651	1	158	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405387	fn3_3	7.05e-23	356	425	1	67	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.
405384	CBM-like	4.02e-15	446	651	2	155	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE63118.1|PL4_3	0.0	1	695	1	695
UDD61144.1|PL4_3	0.0	1	654	1	654
QKD61475.1|PL4_3	0.0	5	654	5	653
EAA59400.1|PL4_3	0.0	6	654	7	650
BCS27293.1|PL4_3	0.0	23	654	20	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NKG_A	8.81e-07	89	493	39	393	Rhamnogalacturonan lyase from Aspergillus aculeatus [Aspergillus aculeatus]
2XHN_A	2.02e-06	89	493	39	393	Rhamnogalacturonan lyase from Aspergillus aculeatus K150A active site mutant [Aspergillus aculeatus],2XHN_B Rhamnogalacturonan lyase from Aspergillus aculeatus K150A active site mutant [Aspergillus aculeatus],3NJV_A Rhamnogalacturonan lyase from Aspergillus aculeatus K150A substrate complex [Aspergillus aculeatus]
3NJX_A	8.05e-06	89	493	39	393	Rhamnogalacturonan Lyase from Aspergillus aculeatus mutant H210A [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U5P7|RGLC_ASPOR	0.0	1	695	1	695	Probable rhamnogalacturonate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rglC PE=3 SV=1
sp|Q5B5P1|RGLC_EMENI	0.0	6	654	7	650	Probable rhamnogalacturonate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rglC PE=3 SV=1
sp|A5ABH4|RGLB_ASPNC	2.57e-238	21	685	19	681	Probable rhamnogalacturonate lyase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rglB PE=3 SV=1
sp|Q5AZ85|RGLB_EMENI	2.43e-237	12	654	9	651	Rhamnogalacturonate lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rglB PE=2 SV=2
sp|B8N5T6|RGLB_ASPFN	7.13e-235	13	654	12	654	Probable rhamnogalacturonate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001585	0.998384	CS pos: 21-22. Pr: 0.9614

TMHMM  Annotations     

There is no transmembrane helices in AO090113000057-T-p1.