CAZyme Information: AO090103000326-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090103000326-T-p1
• CAZy Family: GH92
• CAZyme Description: Ortholog(s) have endo-1,4-beta-xylanase activity and role in xylan catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340	Chr8_A_oryzae_RIB40|CGC14	37081.09	4.4477

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr8_A_oryzae_RIB40:441241-442791(+)

Full Sequence      

MRFQHLTTALAVGVSAHLAQAAGLHDAAVAKGLLYFGTATDNPELTNTSYVTQLNNTGDF
GQITPGNSQKWDSTEPSQNEFSFTNGDVIADLADANDQKLRCHNLVWHQQLPNWVSSGSW
TNETLTAVLQNHITNVVKHYKGRCYAWDVVNEALADDGSYRDSIWYKTIGEAYIPIAFAA
AAAADPDVKLYYNDYSIEWGGAKSTAAQNIVKLIQSYGGKIDGVGLQAHFTVGQTPARKD
LASNLKAFTDLGVEVAYTEVDVRMETPATDANLQQQSTEFSNIVGACLDTEGCVGVTIWD
WTDKYSWVPSTFPGYGAACPWDENFEKKPAYQGILEVLGA

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	24	336	2e-99	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	9.14e-137	24	336	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	6.90e-106	70	334	2	263	Glycosyl hydrolase family 10.
226217	XynA	1.18e-82	7	338	9	341	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE65766.1|GH10	4.11e-257	1	339	1	339
UDD65057.1|GH10	2.40e-256	1	340	1	340
QRD93205.1|CBM1|GH10	5.65e-253	1	339	1	339
AFP43760.1|CBM1|GH10|3.2.1.8	1.48e-248	1	339	1	339
QMW35868.1|CBM1|GH10	3.66e-240	19	339	1	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	2.62e-178	22	340	1	319	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	8.70e-172	6	339	7	340	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3U7B_A	7.36e-118	21	338	2	324	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]
3WUF_A	5.68e-114	22	338	3	312	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	8.05e-114	22	338	3	312	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ZNB1|XYND_TALFU	7.40e-151	9	338	10	334	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|Q9HEZ1|XYNA_PHACH	8.01e-131	22	339	92	407	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|O60206|XLNA_AGABI	9.15e-127	24	336	19	329	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|B7SIW2|XYNC_PHACH	8.41e-126	22	340	82	399	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1
sp|P79046|XYN1_HUMGT	4.79e-122	6	338	7	337	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999717	CS pos: 21-22. Pr: 0.9783

TMHMM  Annotations     

There is no transmembrane helices in AO090103000326-T-p1.