CAZyme Information: AO090103000218-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090103000218-T-p1
• CAZy Family: GH92
• CAZyme Description: Has domain(s) with predicted catalytic activity, chitin binding, chitinase activity, hydrolase activity, hydrolyzing O-glycosyl compounds activity and role in carbohydrate metabolic process, chitin catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1085	Chr8_A_oryzae_RIB40|CGC18	116735.49	4.7976

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr8_A_oryzae_RIB40:714749-718544(-)

Full Sequence      

MSPPLFSKWPFIISLMVYAVRPAWAGNGTCSPTEKCETGCCSREGFCGFGPEFCGDEVCI
SSCDSVAECGKYATTNNTECPLNVCCSQFGFCGTTPEFCDVGCQSGCDAVREPSCSGTSS
EAVYIGYYEGWNFQHPCDVVLPEDINVSPWTHLYYSFAGISIIDFSITTTNPRDEDFWAR
FTSLKKKKPSLKTYISVGGWDVGGTPFSIMVRFPGTRKHFIKSALNMMRKYGFDGIDIDW
EYPAAEDRGGAHSDTANLVNFLKELRAALGSEYGLTVTLPTSYWYLKGFDIANMVQYVDF
FNFMAYDIHGTWDGRTSKWTKSVVNPHTNLTEIAAGLDLLWRNKIDPSKVVLGLGFYGRS
FQLANPSCSTPGCAFYTGHGSSGGALAGECSGTSGILSNYEISRIIKSYDPTIEYDEAAA
VNWMTWSSDQWVSFDNGRTLKQKAKFANNKCLGGLLSWAVDLGGPGSLKNPNLFTDSDLS
MDGADPGGGSDGTGNLYVGAEVLNPDSNSVTAIAPVNIVFPISTLPSPTTIAPSGYPTSL
EVAWPTTKTVTSGNIITVTSTITRYIQTTTIAVPSLTVREHGFYNWNITDKDTTHLVRAL
IPSIRLPPIVITDDPNPLKETSVSHTPAVTRTIHLPPWPWTTDGAKYPRITFTQGGPPGP
TCTAGCGTLCTQFCDGPCLNNCGDAFSRDFISPLDDDPPTVAPCAGKDCKNGKCQGEICI
EKGCTGADCQNRVCVGDDCKPTGCTGPDCDKGHCSGKNCQDHGCVGKDCDKQSGGCFGPL
CLSWGCLGPQCSSTDFVCTGLHCRVVSCSGPSCKNGNCTGPGCMTEDGDCEAKEAESCTE
WISSTMMTPASTYSTQTVTTACKTISACNAKGTTVTKTIDEDGLVEGTVTYIENDVPTDA
ADDAIASSLASYYSSYWSTVDATSTSSTVSSTTTTTSSSGGGQTHDPIPNSLIILKEHVE
DEHFDSSVSHYYKWYSVYYSYRHQVTEKGICALSGKVDGPVKSDEGEEYPTSLGPFALGQ
YTGCLYSGSKHRPGSVKCDNSELAFTCLGYKYNAHAADWNCGKTYTKDGTTHYSNYYKAV
ECLIF

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	123	461	3.2e-72	0.9256756756756757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	1.60e-75	125	463	3	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	6.61e-75	125	462	3	333	Glyco_18 domain.
119351	GH18_chitolectin_chitotriosidase	8.54e-74	127	471	4	353	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
395573	Glyco_hydro_18	2.84e-69	125	461	3	305	Glycosyl hydrolases family 18.
119365	GH18_chitinase	6.72e-63	125	458	2	317	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE65677.1|GH18	0.0	152	1085	24	982
CAP74296.1|CBM18|GH18	9.32e-282	27	870	27	885
QSS62098.1|CBM18|GH18	2.29e-218	25	656	34	672
QSS71211.1|GH18	4.77e-176	174	712	5	648
UKZ69007.1|CBM18|GH18	6.77e-126	27	461	87	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JM7_A	1.24e-49	119	461	1	348	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
5WUS_A	5.73e-49	127	462	7	341	Crystal structure of a insect group III chitinase (CAD2) from Ostrinia furnacalis [Ostrinia furnacalis],5WVH_A Crystal structure of an insect group III chitinase complex with (GlcNAc)6 (CAD2-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
6JM8_A	1.43e-48	119	461	1	348	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis]
5WVF_A	6.47e-48	127	462	7	341	Crystal structure of a mutant insect group III chitinase (CAD2-E647L) from Ostrinia furnacalis [Ostrinia furnacalis],5WVG_A Crystal structure of a mutant insect group III chitinase complex with (GlcNAc)5 (CAD1-E647L-(GlcNAc)5) from Ostrinia furnacalis [Ostrinia furnacalis]
1HKK_A	1.10e-47	122	462	1	341	High resoultion crystal structure of human chitinase in complex with allosamidin [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q13231|CHIT1_HUMAN	3.13e-46	120	462	20	362	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|P36362|CHIT_MANSE	2.93e-45	118	462	19	374	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|Q6RY07|CHIA_RAT	2.98e-45	127	462	27	364	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
sp|Q91XA9|CHIA_MOUSE	1.34e-44	125	462	25	364	Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2
sp|Q9BZP6|CHIA_HUMAN	5.25e-43	127	462	27	364	Acidic mammalian chitinase OS=Homo sapiens OX=9606 GN=CHIA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000272	0.999716	CS pos: 25-26. Pr: 0.9751

TMHMM  Annotations     

There is no transmembrane helices in AO090103000218-T-p1.