CAZyme Information: AO090102000457-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090102000457-T-p1
• CAZy Family: GH76
• CAZyme Description: Has domain(s) with predicted UDP-N-acetylmuramate dehydrogenase activity, flavin adenine dinucleotide binding, oxidoreductase activity and role in oxidation-reduction process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
570	Chr4_A_oryzae_RIB40|CGC7	64460.07	7.0710

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr4_A_oryzae_RIB40:3289499-3291211(-)

Full Sequence      

MATEAIIQDFLTNEVPVFRVGEVEYERSVATANLLYRFTRPDCVVQPRGNGDVQYIVTQA
KARNVSLTIKNGGHSYAGFSSAETGILLDLVRMKKVTIDRKTMIVTLQGGCQWGHAYKQL
VNERMNGAIINGGRCPTVGVSGFTLGGGLGPFTRSFGMGCDTLKEATIVTADGKLVTVTD
GDDPKSDKGRLFWALCGAGGGNYGVVVELKLKIQELQNSGGEVVAGRFTWMPKVDEMDDF
MQTMIRFYTTDWPEQMTLDSSWLCDLKQTSSELGVRVLSYFDGSKDEFDNVINTFVQQPV
LKKQLKRRSMAEPSTRFLHETLVSQWSEETVKSFPTNRSYQIYSSFVFKNDRSRMKAVTE
AIRKEMQAFRKLFNGEQGLLQVTWIHSGGEASRKKRSATAFRWRDCTYHVYIMLQWEDKW
LERDMWGFLGLFKQKLQPYSMMGRAAFINFPDRTLTTEAHEKVYYGNNRQELQRIKRIWD
PDHFFDWKQGIQRPTSTREVQSRMATIQLRTEPDTGTAAADEEEEGGYEVSLDEKDLTDK
IAGSQWNDVSLPPQNAVGGSGVFALTDLGF

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	39	491	2.2e-71	0.9716157205240175

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	4.38e-32	41	179	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	6.30e-26	40	253	31	240	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	1.99e-09	446	491	1	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
178402	PLN02805	4.26e-04	41	216	134	307	D-lactate dehydrogenase [cytochrome]
273751	FAD_lactone_ox	0.009	41	184	15	155	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7214923.1|AA7	1.26e-27	5	485	27	483
QGI84728.1|AA7	3.78e-25	4	492	28	492
CCT71747.1|AA7	3.78e-25	4	492	28	492
QGI98385.1|AA7	3.78e-25	4	492	28	492
QGI67502.1|AA7	3.78e-25	4	492	28	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UD8_A	1.29e-26	40	491	81	527	AtBBE15 [Arabidopsis thaliana],4UD8_B AtBBE15 [Arabidopsis thaliana]
3VTE_A	3.79e-26	40	491	53	510	Crystal structure of tetrahydrocannabinolic acid synthase from Cannabis sativa [Cannabis sativa]
2Y08_A	1.83e-24	21	485	40	519	Structure of the substrate-free FAD-dependent tirandamycin oxidase TamL [Streptomyces sp. 307-9],2Y08_B Structure of the substrate-free FAD-dependent tirandamycin oxidase TamL [Streptomyces sp. 307-9],2Y3R_A Structure of the tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P21 space group [Streptomyces sp. 307-9],2Y3R_B Structure of the tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P21 space group [Streptomyces sp. 307-9],2Y3R_C Structure of the tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P21 space group [Streptomyces sp. 307-9],2Y3R_D Structure of the tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P21 space group [Streptomyces sp. 307-9],2Y3S_A Structure of the tirandamycine-bound FAD-dependent tirandamycin oxidase TamL in C2 space group [Streptomyces sp. 307-9],2Y3S_B Structure of the tirandamycine-bound FAD-dependent tirandamycin oxidase TamL in C2 space group [Streptomyces sp. 307-9],2Y4G_A Structure of the Tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P212121 space group [Streptomyces sp. 307-9],2Y4G_B Structure of the Tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P212121 space group [Streptomyces sp. 307-9]
1ZR6_A	4.96e-24	41	485	43	470	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
5K8E_A	6.37e-24	2	492	22	493	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q796Y5|YGAK_BACSU	3.72e-32	24	491	17	442	Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) OX=224308 GN=ygaK PE=3 SV=4
sp|Q9SA89|BBE12_ARATH	3.27e-28	40	491	76	525	Berberine bridge enzyme-like 12 OS=Arabidopsis thaliana OX=3702 GN=At1g30740 PE=2 SV=1
sp|Q9FZC6|FOX3_ARATH	2.65e-26	3	491	44	521	Berberine bridge enzyme-like 5 OS=Arabidopsis thaliana OX=3702 GN=FOX3 PE=3 SV=1
sp|A0A2V5HCN7|PYVE_ASPV1	3.29e-26	44	485	41	443	FAD-linked oxidoreductase pyvE OS=Aspergillus violaceofuscus (strain CBS 115571) OX=1450538 GN=pyvE PE=3 SV=1
sp|O64743|BBE15_ARATH	6.64e-26	40	491	81	527	Berberine bridge enzyme-like 15 OS=Arabidopsis thaliana OX=3702 GN=MEE23 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AO090102000457-T-p1.