CAZyme Information: AO090102000072-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090102000072-T-p1
• CAZy Family: GH71|CBM24|CBM24
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN5333/plyC, A. fumigatus Af293 : Afu6g14400, Aspergillus flavus NRRL 3357 : AFL2T_09523 and Neosartorya fischeri NRRL 181 : NFIA_060270

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		44010.26	4.0142

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr4_A_oryzae_RIB40:4358945-4360394(+)

Full Sequence      

MRLTPSLISCLSLLHFTSALVAFPGAEGFGANAVGGRQGVVYVVSNLNDSGEGSLRDAVS
QPGRIVVFSVGGVIEITDRIVVSKQVTILGQTAPGDGITVYGNGWSFSNADDAIVRYIRI
RMGKGGSSGKDAMGIADGKNMIFDHVSVSWGRDETFSINGDVSNVTIQNSIIAQGLETHS
CGGLMQTDGGVSLFRNLYIDNKTRNPKVKGVNEFTNNVIYNWGGGGGYIAGGSDGESNVN
VIGNYFISGLDTSVTAFTRGNENFHAYVETNYYDSDKDGTLNGSELGVDSTNYGGMDLVT
EKYDYPAVASVLSPDDALTYVTKYAGASKVRDSVDTQLVAQVESYGKDGALISDEADMGG
AGDLDQGTTPTDTDGDGIPDDAEAELGTDPNTADSMDLDTSGYTFLEVWANSLVPSSYA

Enzyme Prediction     

No EC number prediction in AO090102000072-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	71	246	4.4e-56	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226384	PelB	1.08e-06	22	330	30	344	Pectate lyase [Carbohydrate transport and metabolism].
408654	TSP3_bac	1.69e-04	372	393	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE61182.1|PL1_2	4.75e-303	1	419	1	419
QRD90936.1|PL1_2	4.55e-301	1	419	1	419
QMW31873.1|PL1_2	4.55e-301	1	419	1	419
QMW43898.1|PL1_2	1.85e-300	1	419	1	419
UDD60834.1|PL1_2	2.94e-297	1	419	1	419

PDB Hits     

AO090102000072-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UB83|PLYC_ASPOR	8.43e-304	1	419	1	419	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
sp|B8NQQ7|PLYC_ASPFN	8.08e-302	1	419	1	419	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
sp|A1DPF0|PLYC_NEOFI	4.18e-240	5	418	6	419	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
sp|Q0CLG7|PLYC_ASPTN	3.30e-239	1	418	1	418	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
sp|Q4WL88|PLYC_ASPFU	9.80e-239	5	418	6	419	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000455	0.999527	CS pos: 19-20. Pr: 0.9763

TMHMM  Annotations     

There is no transmembrane helices in AO090102000072-T-p1.