CAZyme Information: AO090102000039-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090102000039-T-p1
• CAZy Family: GT90
• CAZyme Description: Has domain(s) with predicted transferase activity, transferring glycosyl groups activity and membrane localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
444	Chr4_A_oryzae_RIB40|CGC29	50383.58	5.1952

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr4_A_oryzae_RIB40:4445615-4447009(-)

Full Sequence      

MTLSRFRNVPLIVAPLVVFLLLNYFFWFRKDTNDAGEEFLQPQNNTNVDPGSNSSGCPKL
PGIHDVLVVLKTGATEALEKVPVHFNTTLKCIPNFVLFSDFEEQIAGVQALDVLRSVDED
IKQTKAEFDLYNRLRDAGRAGLTAEDINDDPSTPSGKPDNRGWLLDKWKFLPMINETLNI
RADAKWYVFIEADTYVVWPNLLSWLEKFDPSQPYYMGSGVRILDVVFGHGGSGLVLSQAA
MHKVSDYRAPRVKEYDDFTAGQWAGDCVLGKALKDAGVGLFFANPMLQGDTPWTFSHYGP
NNNDHHWCTPVVTYHHMTPDDIRETWAFEQSWWANTQSHTLLHADVFEEFVRPQIEQMKE
NWDNASSDENIEGSNSREDCQAQCEKDRECHQYSYETGKCLTSKVARRGSSKAGIGSGWM
PERINKTMESLGHCRNVRWITPKS

Enzyme Prediction     

No EC number prediction in AO090102000039-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238532	PAN_AP_HGF	0.002	375	411	25	65	Subfamily of PAN/APPLE-like domains; present in N-terminal (N) domains of plasminogen/hepatocyte growth factor proteins, and various proteins found in Bilateria, such as leech anti-platelet proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.
367085	Fringe	0.002	183	245	84	160	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
394981	PAN_1	0.004	366	401	14	51	PAN domain. The PAN domain contains a conserved core of three disulphide bridges. In some members of the family there is an additional fourth disulphide bridge the links the N and C termini of the domain. The domain is found in diverse proteins, in some they mediate protein-protein interactions, in others they mediate protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE61153.1|GT31	0.0	1	444	1	444
QRD90967.1|GT31	0.0	1	444	1	444
UDD60864.1|GT31	0.0	1	444	1	444
QMW31901.1|GT31	0.0	1	435	1	435
QMW43934.1|GT31	0.0	1	435	1	435

PDB Hits     

AO090102000039-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q18515|C1GLT_CAEEL	3.19e-06	163	340	161	319	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=C38H2.2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000003

TMHMM  Annotations     

Start	End
9	28