CAZyme Information: AO090102000035-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090102000035-T-p1
• CAZy Family: GH71
• CAZyme Description: Has domain(s) with predicted catalytic activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	Chr4_A_oryzae_RIB40|CGC2	40812.95	4.1604

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr4_A_oryzae_RIB40:4456297-4457548(+)

Full Sequence      

MSPSPRSLLAPLLLATCVSAESVAISRAETALTTLQTWYNSSTGMWNTCGWWNGANCMTV
LADLALVDDSESVNNTVKEVFANTFSVGPVSNPYPDRNNDSYYSSAVQSKRSVDATQWLD
GSYDDDAWWGLAWIAAYDVTGIEDYLDLAAGIFKHLSQAWPSKCGNGGIDSDFQHIYVNA
ITNELFFSLAAHLANRASDRDYYVDWARRQWTWFKDSGMINVNNTINDGLSSDCKNNGGT
IWSYNQAVVLGGLAELDRAVSNESYVDAAAKLANASIAYFADDNDIIHESCEPDSCDSNE
TQFKGIFIRNLKLLHSVAPNDVYAKVINASANSIWQNDRNAQNQLGVDWAGPVSQVDAST
HSSAMDALVAAIGI

Enzyme Prediction     

No EC number prediction in AO090102000035-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	21	369	2e-94	0.9385474860335196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.46e-42	26	350	4	331	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.82e-12	96	371	69	349	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW31905.1|GH76	4.00e-279	1	374	1	374
QRD90972.1|GH76	4.00e-279	1	374	1	374
QMW43938.1|GH76	4.00e-279	1	374	1	374
BAE61149.1|GH76	4.00e-279	1	374	1	374
UDD60869.1|GH76	4.00e-279	1	374	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	1.96e-08	124	363	135	378	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6SHM_A	1.93e-07	128	363	140	379	An inactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.93e-07	128	363	140	379	Chain A, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P6I3|YHG7_SCHPO	1.88e-21	119	322	103	321	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|Q05031|DFG5_YEAST	3.51e-15	113	333	111	349	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1
sp|P36091|DCW1_YEAST	8.20e-15	124	319	117	326	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q9P6I4|YHG6_SCHPO	1.16e-14	124	319	110	319	Putative mannan endo-1,6-alpha-mannosidase C1198.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.06c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000487	0.999479	CS pos: 20-21. Pr: 0.9760

TMHMM  Annotations     

There is no transmembrane helices in AO090102000035-T-p1.