CAZyme Information: AO090102000010-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090102000010-T-p1
• CAZy Family: GH71
• CAZyme Description: Ortholog(s) have pectinesterase activity and role in pectin catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	Chr4_A_oryzae_RIB40|CGC17	34618.16	4.2334

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr4_A_oryzae_RIB40:4512294-4513406(+)

Full Sequence      

MHGSLLKLALLSFSLGSSAAVLPRDTGRTSAPSGCSTVGTSGDYSTIGDALTALGSSTAD
ACIYIAAGTYEEQLVINYAGHLTLYGETTDTQTYKQNTVTITHTISSPEAGSLDNSATVN
IKSDLVSVYNINIANGYGSGAQAVALVANADQLGFYACQFTGYQDTLYAKAGHQYYINSR
IEGAVDYIFGDASAWFENCDIVSNGAGYITAMSRETTSDTAWYAIDHCNIKAASGVDLTG
DVYLGRPWRVLARVIYQYSVLPDIINAKGWHSMADGATPLYYEFNNTGAGSDTSDREYLS
TIDAPVTKETVLGDDYKNWVDLSY

Enzyme Prediction     

EC	3.1.1.11:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	40	298	9.9e-79	0.8993055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	2.73e-54	41	296	9	271	Pectinesterase.
178372	PLN02773	2.20e-45	41	296	14	275	pectinesterase
178051	PLN02432	2.67e-42	42	316	21	291	putative pectinesterase
215383	PLN02713	1.38e-39	41	296	259	524	Probable pectinesterase/pectinesterase inhibitor
215357	PLN02665	3.30e-39	41	296	77	333	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE61126.1|CE8	8.79e-235	1	324	1	324
QRD90995.1|CE8	3.43e-232	1	324	1	324
QMW31927.1|CE8	3.43e-232	1	324	1	324
QMW43961.1|CE8	1.99e-231	1	324	1	324
UDD60894.1|CE8	7.75e-229	1	324	1	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	1.69e-165	28	324	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	3.41e-165	28	324	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1XG2_A	2.53e-28	42	296	13	274	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	6.93e-27	41	296	16	278	Pectin methylesterase from Carrot [Daucus carota]
2NSP_A	6.94e-16	44	314	18	336	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UBD9|PMEA_ASPOR	1.56e-235	1	324	1	324	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	6.10e-233	1	324	1	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|A2QK82|PMEA_ASPNC	1.18e-164	9	324	12	327	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	1.71e-154	13	324	10	325	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.10e-152	6	324	6	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000261	0.999714	CS pos: 24-25. Pr: 0.7008

TMHMM  Annotations     

There is no transmembrane helices in AO090102000010-T-p1.