CAZyme Information: AO090038000019-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090038000019-T-p1
• CAZy Family: PL1
• CAZyme Description: protein of unknown function

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
257	Chr6_A_oryzae_RIB40|CGC20	29000.26	4.0016

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr6_A_oryzae_RIB40:3609124-3609897(-)

Full Sequence      

MTPYLMLLLDNEGYQAGNEGPIHFISDGDDQGAGFVADYRSTMTGLLMEYLEYLNKWTHD
TLGLKLSQQVGYNLPVDMLEAIPSVDIPEIETLSFSNLIDGFRQFSGPANLAGKNVISIE
LGADFGQAYYQTWTELLQEAQHAFVAGVNQLAIHDATYSHTYDNTTWPGFTSFNYSFAEQ
HSRHQPGWDVGYKQAMDYLARCQFILQEGIAKVDLVFWDKQIAQDAYPGILYEPTDLQDA
GYTYEYLSTENFNLPMA

Enzyme Prediction     

No EC number prediction in AO090038000019-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407266	Glyco_hydro_106	2.06e-09	30	250	480	703	alpha-L-rhamnosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE63878.1|GH106	3.89e-193	1	257	1	257
QMW39076.1|GH106	4.67e-141	1	257	224	447
UDD54805.1|GH106	8.88e-130	1	247	188	401
QMW26995.1|GH106	1.47e-128	1	247	191	404
QRD81330.1|GH106	9.47e-113	1	175	111	285

PDB Hits     

AO090038000019-T-p1 has no PDB hit.

Swiss-Prot Hits     

AO090038000019-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000084	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AO090038000019-T-p1.