CAZyme Information: AO090026000805-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090026000805-T-p1
• CAZy Family: GH5
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN7548, A. fumigatus Af293 : Afu2g14740, A. niger CBS 513.88 : An15g03570, Aspergillus wentii : Aspwe1_0118903 and Aspergillus sydowii : Aspsy1_0045980

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		49741.99	6.5054

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr3_A_oryzae_RIB40:2939758-2941140(+)

Full Sequence      

MRWSQGHSTRLRFLGTGAVCSLIAVTFLFFSTKYSAEVAKYALKAPVKQSPLGSPPACRN
DSSWEFQVEKDGNDHGLSEEQCHAAFPKLFVELDKSASFRENNPIQFKDVDSLTVENGMV
RGIIDHGELYIVDFGNMPATFTRGKATLNSLHRALASFPDRDRLPNVEFVLTTEDYSSGE
GPIWSYSKREENTNVWLMPDFGYWSWPEVGVGPYKDARRRIAAIDDGEVTVDGQVIPGMQ
FQDKKKQLVWRGNVATNPQVRGKLLKAAQGRSWASILAIDWGDENDIRFNLLPIEEHCRY
MFLAHTEGRSFSGRGKYLLNCRSVVISHKLVWREAHHAALISSGPEANYVEVERDFSDLD
HKIEFLIDNPEAAERIANNSVKTFRDRYLTPAAESCYWRHLIRQYASSSEFEPVLYTTRE
DGKKEPRGIPFETWVLGS

Enzyme Prediction     

No EC number prediction in AO090026000805-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	164	407	1.6e-30	0.976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	4.79e-27	163	425	78	335	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	1.12e-24	163	406	1	250	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD61446.1|GT0	0.0	1	438	1	438
QMW41857.1|GT0	0.0	1	438	1	460
QMW29784.1|GT0	0.0	1	438	1	460
BCS13796.1|GT0	1.82e-251	1	436	1	439
BCS02108.1|GT0	1.82e-251	1	436	1	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	7.06e-12	164	412	128	382	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	5.78e-10	163	406	93	339	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0X1Q4|RUMI_CULQU	8.63e-13	159	412	132	392	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	2.05e-11	159	412	133	391	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q8T045|RUMI_DROME	3.76e-11	164	412	140	394	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	4.62e-10	163	421	121	379	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q29AU6|RUMI_DROPS	4.91e-10	164	412	138	392	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999252	0.000774

TMHMM  Annotations     

Start	End
13	32