CAZyme Information: AO090026000114-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090026000114-T-p1
• CAZy Family: GH43
• CAZyme Description: Has domain(s) with predicted catalytic activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461		51010.99	4.5024

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr3_A_oryzae_RIB40:4792983-4794478(-)

Full Sequence      

MSMIAVSDLAPSIPLSLNYPAHTEEIESLKDAASTAARGMLKYYHGNEPGQTPGTLDGTW
WEAGAMFMTLVQYWRVSGDSSYNDLTTQGLQWQSGDDHDYLPANSSAYLGNDDQMFWGLA
AMTCAESRYPDVSDGPSWLSLVQGVFNNQIPRWEMQTCHGGLRWQIHSWLPGYDLKNTIS
NGGLFQIAARLARYTGDQKYADWATKIWDWIASSPLLDTKTWNVADTTSVTNDCTTNGNE
QWTYNYGTLLSGAAYMYNLSHPNPRSQTNGDQKWLDAVDGLLNASLRLFFPPMYNNGTVL
SEVSCETIETCDRNQMCFKGFLSIWMAYTATLVPSTAERIIPRLQGSAEAAARQCSGGED
GTACGVRWYEDKWDGKNGLETQMSSLSIFTANLMLQSDEQPVTSTTGGESKSDPDAGTGG
KSRKPEEPRKIKAGDRAGAWIMTLVVGVAWIVIIVWLVWEK

Enzyme Prediction     

No EC number prediction in AO090026000114-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	23	403	1.7e-108	0.9692737430167597

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	0.0	28	386	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE59608.1|GH76	0.0	1	461	1	461
QMW42440.1|GH76	0.0	12	461	24	462
QMW30368.1|GH76	0.0	12	461	24	462
QRD86852.1|GH76	0.0	12	461	24	459
UDD62122.1|GH76	4.14e-317	40	461	1	414

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.26e-96	27	436	34	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	3.89e-115	24	458	24	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	5.91e-110	24	458	27	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|P36091|DCW1_YEAST	6.26e-109	24	458	27	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q5AD78|DCW1_CANAL	1.96e-102	23	458	23	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q9P6I3|YHG7_SCHPO	1.81e-97	27	418	28	403	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998220	0.001789

TMHMM  Annotations     

Start	End
437	459