CAZyme Information: AO090023000158-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090023000158-T-p1
• CAZy Family: GH32
• CAZyme Description: Ortholog(s) have feruloyl esterase activity and role in xylan catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
257		27114.60	6.7530

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr3_A_oryzae_RIB40:400393-401206(-)

Full Sequence      

MIKSIILQAIMVLSTLTSVHGANSSGCGKQPTLVNGVHKINDREYILKVPDNYNANKPHH
LIFGLHWRGGNMNSVVNGESVEPWYGLETRAQGSAILVAPNGRNAGWANINGEDVALIDA
IIKQVEDDLCIDQSSRFATGFSWGGGMSYALACARAKEFRAVSVLSGGVISGCEGGHDPI
AYLGIHGISDPFAANNGCQQTYVGKPGLGSHSSVQTDFKGCSRPVSFIAYDGGHDAAPLG
VGNPLAPDATWKFFMAA

Enzyme Prediction     

No EC number prediction in AO090023000158-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	42	171	1.2e-21	0.5859030837004405

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	6.38e-13	4	209	11	214	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
223489	DLH	7.98e-05	115	192	93	171	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
224423	DAP2	0.004	50	169	385	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
226584	COG4099	0.007	116	168	251	303	Predicted peptidase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSB17085.1|CBM2|CE0	1.58e-80	24	254	36	285
EGX54170.1|CBM1|CE0	2.22e-77	22	254	92	352
QBZ61811.1|CBM1|CE0|GH27	3.48e-74	21	254	704	965
BCJ61433.1|CBM2|CE0	4.31e-74	22	254	55	321
QUC63414.1|CBM2|CE0	4.54e-73	22	254	36	296

PDB Hits     

AO090023000158-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UI81|FAEC_ASPOR	2.08e-189	1	257	1	270	Probable feruloyl esterase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=faeC PE=3 SV=2
sp|B8N7Z6|FAEC_ASPFN	6.95e-188	1	257	1	270	Probable feruloyl esterase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=faeC PE=3 SV=1
sp|Q5B2G3|FAEC_EMENI	1.01e-148	1	257	1	270	Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=faeC PE=1 SV=1
sp|A2QYU7|FAEC_ASPNC	5.57e-146	1	257	1	270	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
sp|A4D9B6|FAEC_ASPFU	4.90e-145	1	257	1	272	Probable feruloyl esterase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=faeC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999773	CS pos: 21-22. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in AO090023000158-T-p1.