CAZyme Information: AO090023000067-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090023000067-T-p1
• CAZy Family: GT90
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN6460, AN12398, A. oryzae RIB40 : AO090010000683, Aspergillus wentii : Aspwe1_0075588, Aspergillus versicolor : Aspve1_0086685 and Aspergillus zonatus : Aspzo1_1970012

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442		49079.94	6.8851

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr3_A_oryzae_RIB40:180363-181786(-)

Full Sequence      

MDRAPASAKPRRSIVRGHMHQRCAAGLPPKDSFSNARQGTAELKECHVRQTRAKFRSAAQ
ALYLNLCPLMHQSGILRKTAMFLATRQLLLVGTAASFLLLLWYTQRIFVSRTVSLPAPTL
TPTPTPVPTPAERVSTTPKPPVQSAGNSTLGFQSILALSTGPSWRTRGLLAAASLTGLDI
QIPPQPPVNPNLVDAFEHMGPDNVQHPSHGASIAWLAHLDLIKHTIQANLDTVLIIEDDV
DWDVSIRSQMVQIAESVRNLTHIDTLDQDMEPYGREWEVLWIGHCGEYWEEQFETVLYDD
PTACPHSDYFGWAKQYIERLPDRQRAVYRSVNPVCSFAYALSREGSRKILEVLGGAQDEA
FDVSMMHACKAGQLKCISVVPEVVHQYFPAQSFGVKSAVDVGNGQEPGPEEAEFEHVMGS
TENILESARCRALWGQRCLRKQ

Enzyme Prediction     

No EC number prediction in AO090023000067-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	2.02e-04	165	243	13	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE58653.1|GT25	0.0	1	442	1	442
QRD85193.1|GT25	4.97e-301	1	442	1	434
UDD59205.1|GT25	1.24e-258	81	442	1	362
QMW28939.1|GT25	1.32e-253	81	442	1	362
QMW41014.1|GT25	1.32e-253	81	442	1	362

PDB Hits     

AO090023000067-T-p1 has no PDB hit.

Swiss-Prot Hits     

AO090023000067-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000004

TMHMM  Annotations     

Start	End
82	104