CAZyme Information: AO090020000447-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090020000447-T-p1
• CAZy Family: PL1
• CAZyme Description: Has domain(s) with predicted role in biosynthetic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		35722.06	8.7682

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr6_A_oryzae_RIB40:683309-684664(-)

Full Sequence      

MNPPGVEKAISLAAGTLMKGSGLEGTPMLYHQTDTLLEYHPRDLPFCITHHAPFHRHFAG
VFSEALAAHAYGDADKAEHLARKQEVGIKLLKHRVNGHVLQISRLQGKLLLSYGVNAAKI
REICPSIQLSSSSYHVESEIAEVFNTGGVTLFTAVARVDYFKNVDLLVDVAVALWSQNIA
VRLFIAGGASMDSTELHELSKKVPRQFTRYATFRSKLSRTSLHALFRLAKDSGVFICPSR
YETLGVTPLEAALSGVTSLIANSSHVEASRYFPERFRFQPVKEELCQTILNLQGRNLASL
GEILRLHVEAQVSDQRFRMDLL

Enzyme Prediction     

No EC number prediction in AO090020000447-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340838	GT4_MtfB-like	1.22e-12	29	292	87	330	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
340830	GT4_sucrose_synthase	1.38e-12	154	256	225	327	sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.
340831	GT4_PimA-like	1.83e-12	66	256	110	292	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
223515	RfaB	1.12e-11	46	256	104	301	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
395425	Glycos_transf_1	2.72e-11	155	256	8	103	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD94581.1|GT4	8.48e-227	1	321	49	369
QMW33721.1|GT4	8.48e-227	1	321	49	369
QMW45767.1|GT4	8.48e-227	1	321	49	369
UDD62545.1|GT0	8.48e-227	1	321	49	369
APA07210.1|GT4	5.96e-76	1	322	78	403

PDB Hits     

AO090020000447-T-p1 has no PDB hit.

Swiss-Prot Hits     

AO090020000447-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AO090020000447-T-p1.