CAZyme Information: AO090020000174-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090020000174-T-p1
• CAZy Family: GH3
• CAZyme Description: Has domain(s) with predicted role in lipopolysaccharide biosynthetic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	Chr6_A_oryzae_RIB40|CGC13	45166.78	5.4410

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr6_A_oryzae_RIB40:1384643-1385988(+)

Full Sequence      

MTFVMSRWNTKTIIKLVAAACCSYFIFTILLADREAYYSTTRDVIRAGQHHLTEETTFDH
INNETLGFQHIYAIGMKERTDKRDYLTLAASFLGIKVDWRDGVYPDNVSEKSYPLKLGES
GVKPAAIGCWRAHMNTLIDIVENGYTTALILEDDADWDVSLRQQLAEFARGVRTLTNNQH
ESKKAPYGTNWDILWVGGCASGAHQNETDFYVIPNDPTVPNTTIRGPWESPAGPSIQWRQ
EHPEWPVDSTRYIYRANMGCCTFGYAVTLEGARRILAELSINYLNLPVDNAMSDLCAGSN
RPQLRCYAPFPNLIGTFRSEGYVSRDSDIDQWEDRKFEWHPALAYNMVYSTRLNIHRLVA
GEETVYSQWRESPDPWSKAEVKLGELEYPRGVFVSQ

Enzyme Prediction     

No EC number prediction in AO090020000174-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	68	292	2.4e-33	0.994475138121547

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	9.12e-19	70	158	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	2.29e-07	68	292	1	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
225843	COG3306	2.79e-04	67	295	1	190	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE63398.1|GT25	2.43e-307	1	396	1	396
QRD94314.1|GT25	2.43e-307	1	396	1	396
UDD62811.1|GT25	2.43e-307	1	396	1	396
QMW33955.1|GH13_40|GT25	1.71e-273	1	396	568	940
QMW46009.1|GH13_40|GT25	1.71e-273	1	396	568	940

PDB Hits     

AO090020000174-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5PK45|GT251_BOVIN	9.85e-10	49	347	319	595	Procollagen galactosyltransferase 1 OS=Bos taurus OX=9913 GN=COLGALT1 PE=2 SV=1
sp|Q8K297|GT251_MOUSE	1.30e-09	63	347	330	589	Procollagen galactosyltransferase 1 OS=Mus musculus OX=10090 GN=Colgalt1 PE=1 SV=2
sp|Q8NBJ5|GT251_HUMAN	1.73e-09	64	347	336	594	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1
sp|Q7Q021|GLT25_ANOGA	6.66e-08	61	289	311	498	Glycosyltransferase 25 family member OS=Anopheles gambiae OX=7165 GN=AGAP012208 PE=3 SV=4
sp|Q5U483|G251B_XENLA	2.09e-07	30	334	290	568	Procollagen galactosyltransferase 1-B OS=Xenopus laevis OX=8355 GN=colgalt1-b PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999985	0.000029

TMHMM  Annotations     

Start	End
13	32