CAZyme Information: AO090020000066-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090020000066-T-p1
• CAZy Family: GH3
• CAZyme Description: Has domain(s) with predicted transferase activity, transferring glycosyl groups activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	Chr6_A_oryzae_RIB40|CGC15	35578.32	6.3397

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr6_A_oryzae_RIB40:1640241-1641429(-)

Full Sequence      

MVQQPKQEKVWASLITNLSYLPGILTLSHSLQTTETAYPFIALYTSTFPAEGLAALHARG
IRTQAVPSVQPGQSRVFLQDPRFNETWNKLIVFSLVEYDRIVLLDGDMLVRKNMDELMDV
PLDGPGSGLSSEENKQERVFAASHVCACNPLNKPHYPKTWIPKNCAYTSQHSDPVRAQTS
GAPAATGVAMLNSGLLVVRPTISAWAEIQARLHMPDRTDKYTFPDQELLSDVFRGRWVVL
PYVYNALKTLRWEGVHDDIWRDDEVKNVHYIFANKPWHEDPDDGMDEPSRWWWEVNRQRQ
QLEVKKGITDGH

Enzyme Prediction     

No EC number prediction in AO090020000066-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	8	280	1.7e-41	0.8871595330739299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	7.64e-61	10	299	2	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133037	GT8_A4GalT_like	2.39e-15	84	278	81	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
215090	PLN00176	4.15e-14	20	295	35	290	galactinol synthase
279798	Glyco_transf_8	8.27e-13	13	280	3	251	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
227884	Gnt1	2.14e-08	78	121	148	191	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD94212.1|GT8	2.63e-239	1	312	1	312
BAE63310.1|GT8	2.63e-239	1	312	1	312
QMW46104.1|GT8	2.63e-239	1	312	1	312
QMW34049.1|GT8	2.63e-239	1	312	1	312
UDD62921.1|GT8	2.63e-239	1	312	1	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	3.31e-11	11	292	10	253	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]
1ZCY_A	1.19e-06	8	278	23	241	Chain A, Glycogenin-1 [Oryctolagus cuniculus],1ZDG_A Chain A, Glycogenin-1 [Oryctolagus cuniculus]
6U4B_A	1.22e-06	86	309	386	606	Chain A, WbbM protein [Klebsiella pneumoniae]
3U2T_A	1.25e-06	4	278	21	243	Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese [Homo sapiens]
3USQ_A	1.29e-06	8	278	23	241	Structure of D159S/Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O22893|GOLS1_ARATH	3.02e-17	17	309	39	311	Galactinol synthase 1 OS=Arabidopsis thaliana OX=3702 GN=GOLS1 PE=1 SV=1
sp|Q5UNW1|YR707_MIMIV	9.61e-17	17	278	13	235	Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R707 PE=4 SV=1
sp|C7G304|GOLS2_SOLLC	1.35e-16	17	295	33	291	Galactinol synthase 2 OS=Solanum lycopersicum OX=4081 GN=GOLS2 PE=2 SV=1
sp|Q9XGN4|GOLS1_AJURE	3.26e-16	17	295	32	290	Galactinol synthase 1 OS=Ajuga reptans OX=38596 GN=GOLS1 PE=1 SV=1
sp|Q8H1S1|GOLS6_ARATH	4.57e-16	17	295	34	293	Galactinol synthase 6 OS=Arabidopsis thaliana OX=3702 GN=GOLS6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000005	0.000030

TMHMM  Annotations     

There is no transmembrane helices in AO090020000066-T-p1.