CAZyme Information: AO090012000636-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090012000636-T-p1
• CAZy Family: GH28
• CAZyme Description: Has domain(s) with predicted hydrolase activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
250		26693.47	8.0422

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr4_A_oryzae_RIB40:1623159-1623911(-)

Full Sequence      

MGVVSISGSCCRLRWAAPPSPPALYGEPQPTGAIKVSGGYAKQVSSDFPKSHFAVWGRAA
AVDKGLIKEVMAAHPADLMLLLLGFNDMGWFYSDSIGTLDSIHTLISNARAANPKIKFAI
ANVPQRSFIGGREDLPVSTNIYNSLLRDTIPKWSTTASPIHPVELEENYNCQPSSCPVGS
DGLHPNAMGEYQIARAFSQTLVKDFRIGSSALSIPNDVPARPLPVPSNFKVFTSPGGVTA
TWDPGKPPCS

Enzyme Prediction     

No EC number prediction in AO090012000636-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	38	201	5e-31	0.7989690721649485

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.21e-34	50	201	15	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.50e-05	69	193	55	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	2.26e-04	52	197	40	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	0.002	45	192	16	158	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225353	TesA	0.004	75	203	77	210	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE60780.1|CE0	8.15e-187	1	250	1	250
CAK39824.1|CE0	1.72e-94	19	229	184	395
BAE63679.1|CE0	2.03e-92	19	228	109	317
SCG40251.1|CE0	8.63e-71	16	243	385	612
UKZ09962.1|CE0	4.03e-70	18	244	563	791

PDB Hits     

AO090012000636-T-p1 has no PDB hit.

Swiss-Prot Hits     

AO090012000636-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AO090012000636-T-p1.