CAZyme Information: AO090012000349-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090012000349-T-p1
• CAZy Family: GH27
• CAZyme Description: Protein with similarity to formate oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578		64365.12	6.0701

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr4_A_oryzae_RIB40:857172-858908(+)

Full Sequence      

MATDGSHFDFVIVGGGTAGNTVAGRLAENPNVTVLIVEAGIGNPEDIPEITTPSSAMDLR
NSKYDWAYKTTMVRRDDYERIEKPNTRGKTLGGSSSLNYFTWVPGHKATFDQWEEFGGKE
WTWDPLVPYLRKSATYHDDPRLYSPELEKIGGGGPIPISHAELIDEMAPFRENLTKAWKS
MGQPLIENIYDGEMDGLTHCCDTIYRGQRSGSFLFVKNKPNITIVPEVHSKRLIINEADR
TCKGVTVVTAAGNELNFFADREVILSQGVFETPKLLMLSGIGPTRELSRHGINTIVDSRH
VGQNLMDHPGVPFVLRVKDGFGMDDVLLRHGPKRDAVVSAYNKNRSGPVGSGLLELVGFP
RIDKYLEKDAEYRKAKAANGGKDPFSPLGQPHFELDFVCMFGTAFQWHFPTPKTGDHLTV
VVDLVRPISDPGEVTLNSADPFQQPNINLNFFANDLDIIAMREGIRFSYDLLFKGEGFKD
LVESEYPWEMPLDSDKEMHRAVLDRCQTAFHPTGTARLSKNIDQGVVDPKLKVHGIKKLR
VADASVIPIIPDCRIQNSVYAVGEKCADMIKAEHKDLY

Enzyme Prediction     

No EC number prediction in AO090012000349-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	572	1.2e-147	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.77e-88	1	575	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.69e-81	7	571	5	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.82e-37	427	566	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.01e-23	87	309	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.85e-16	8	563	56	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD59638.1|AA3_2	0.0	1	578	1	578
QMW42855.1|AA3_2	0.0	1	578	1	578
QRD89697.1|AA3_2	0.0	1	578	1	571
QMW30802.1|AA3_2	0.0	1	578	1	567
BCR85434.1|AA3_2	0.0	1	578	1	578

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZU3_A	0.0	2	578	1	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3Q9T_A	0.0	2	578	1	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	0.0	2	578	1	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.57e-70	8	573	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.09e-70	6	573	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	5.96e-62	8	570	7	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	1.35e-60	8	570	41	595	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|M5EAX2|GMCH_MALS4	9.63e-60	4	570	43	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	9.63e-60	4	570	43	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|Q47944|SDH_GLUOY	1.27e-57	6	571	3	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000008

TMHMM  Annotations     

There is no transmembrane helices in AO090012000349-T-p1.