CAZyme Information: AO090012000343-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090012000343-T-p1
• CAZy Family: GH27
• CAZyme Description: protein of unknown function

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		38437.09	7.3452

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr4_A_oryzae_RIB40:841608-842889(+)

Full Sequence      

MKAYRYALYRRTRRLRLALFFVLLGWTLVEVLRIKYTLVQQSQPELVALGSEKIYITGLH
WNSELILRDAWIAAVVDLANTIGRDNVFVSIQESGSWDDTKGALILLDQLLAENDIPRRI
LIDYTTHFDEISKPPTGQGWIETPIGTTELRRIPYLAKLRNVAMEPLYELQNEGIVYDKI
LFLNDVIFTTSDVQRLLSTKGGNYAATCSLDFSKPPDFYDTFALRDAEGHDMLMQSWPYF
RSRASRQAMKASQPVPVSSCWNGVVAMDAAPFYQHPPLKFRGISDSLAKSHLEGSECCLI
HADNPLSREKGVWLNPNSGRGCGSGKSSRAEIWNLGLFVL

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	53	305	7.8e-88	0.9916317991631799

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	6.12e-124	53	300	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE60536.1|GT69	1.56e-252	1	340	1	340
QRD89692.1|GT69	9.07e-233	1	317	1	317
QMW30798.1|GT69	9.07e-233	1	317	1	317
QMW42851.1|GT69	9.07e-233	1	317	1	317
UDD59634.1|GT69	9.07e-233	1	317	1	317

PDB Hits     

AO090012000343-T-p1 has no PDB hit.

Swiss-Prot Hits     

AO090012000343-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999867	0.000157

TMHMM  Annotations     

Start	End
17	34