CAZyme Information: AO090012000135-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090012000135-T-p1
• CAZy Family: GH24
• CAZyme Description: Glycoside hydrolase family 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768		82362.73	4.6314

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr4_A_oryzae_RIB40:327271-329907(-)

Full Sequence      

MHAIAGLTGLLAGVSLSYAAPTHENITSDAYFYGQSPAVYPSPEGTGSGAWASAYEKAKA
FVANLTPEEKVNLTAGTDADNGCSGNIPAIPRLNFPGLCVSDAGNGLRSTDHVNAWSSGI
HTGASWNKDLAQKRGLHMGSEYHKKGVNVLLGPVVGPLGRIAEGGRNWEGFSVDPYHSGL
LVYETIRGIQAAGVGTSTKHYIANEQETNRNPESTDGIDVAAVSSNIDDKTMHELYLWPF
QDVVRAGSVSIMCSYQRINNSYGCQNSKTLNGLLKTELGFQGYVMTDWGAQHGGIASSNA
GLDMVMPSSTLWNSNLTDAIANGTMEASRLDDMATRIIASWYQMNQDAGFPSPGVGMPAD
VYAPHQAIIGKSSDSRKVLLQSAIEGHVLVKNKNNTLPLKSPEMISVFGYDAKGPDSLGF
ALEWLSYSPAIQPNHTLIVGGGSGGNSPAYISAPLDALQQQVIEDGSSILWNISAQDPEV
DPNTDACLVFINSYATEGYDRAGLVDEGSDELVTNVASKCSNTIVTIHNAGIRLVNNWID
HENVTAVIFAHLPGQDSGRALVELLYGRSNPSGKLPYTVAKSADDYGALLHPKLPEGQYG
LFPQDDFSEGVYIDYRAFDKQGIEPQFEFGFGLSYTTFDYSGLNIGQVSDNSTSRYPPSA
AIQEGGNPHLWDVILRVSVDITNSGPVAGDEVAQLYVGIPNGPVRQLRGFEKVNIPVGQT
VTVEFALGRRDLSTWDVVAQEWLLQSGTYQVYVGRSSRDLPLQGEFTI

Enzyme Prediction     

EC	3.2.1.21:10	3.2.1.37:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	89	307	3.8e-56	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	4.03e-51	388	615	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	3.17e-47	124	768	128	764	beta-glucosidase BglX.
224389	BglX	6.05e-44	88	416	53	368	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
405066	Fn3-like	4.31e-28	691	757	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.
395747	Glyco_hydro_3	1.37e-27	123	338	95	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE60358.1|GH3	0.0	1	768	1	768
QMW30621.1|GH3	0.0	1	768	1	768
QMW42674.1|GH3	0.0	1	768	1	768
QRD89508.1|GH3	0.0	1	768	1	768
UDD59438.1|GH3	0.0	1	768	1	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JU6_A	2.01e-201	9	763	4	848	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
4IIB_A	4.38e-199	36	762	6	833	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
6SZ6_A	5.97e-195	36	762	4	831	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5NBS_A	3.93e-186	21	763	7	853	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
5FJJ_A	7.06e-186	36	763	7	835	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UDK7|BGLM_ASPOR	0.0	1	768	1	768	Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglM PE=3 SV=1
sp|B0XPB8|BGLM_ASPFC	0.0	4	768	7	769	Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglM PE=3 SV=1
sp|Q4WR62|BGLM_ASPFU	0.0	4	768	7	769	Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglM PE=3 SV=1
sp|B8N5S6|BGLM_ASPFN	0.0	1	768	1	768	Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglM PE=3 SV=1
sp|Q0C7L4|BGLM_ASPTN	0.0	1	768	1	782	Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000427	0.999539	CS pos: 19-20. Pr: 0.9802

TMHMM  Annotations     

There is no transmembrane helices in AO090012000135-T-p1.