CAZyme Information: AO090012000101-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090012000101-T-p1
• CAZy Family: GH20
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN5231, A. fumigatus Af293 : Afu7g06430, Aspergillus wentii : Aspwe1_0167924, Aspergillus sydowii : Aspsy1_0091759 and Aspergillus terreus NIH2624 : ATET_07909

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	Chr4_A_oryzae_RIB40|CGC33	37022.30	6.1722

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr4_A_oryzae_RIB40:246623-247704(+)

Full Sequence      

MDTDRASLPNNTSTINHLHSKDIQASFLGTVTLKMVTGTFTPTNTGKTRVLAVSRSTDGG
RTFQDWGEVSRGEGDVDNVFLLEVAPGTVLGAFRNHDIGPHGPTYFRITVCRSTDAGRSW
HFLSQAAEKGAPNGIWEPFMRLGRQGEVQLTYSLEFAHNNQSTMMVQSFDGGATWTQPRC
LHGDCDALRDGMNGIAPTWDNGREALVMIFETTSFGTFNLEALISYDDGQTWGWRHRVYV
PPQGHNAGAPQIASFADGSLAVIFMTDEDHNEVSWTQNASIKVVFAGPPQNGQIQWSKPT
VICPHTSHWPGIAPVDGNTLFATFECEGRPKAKAITLH

Enzyme Prediction     

No EC number prediction in AO090012000101-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	39	283	1.1e-66	0.8469055374592834

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	8.57e-10	37	270	99	328	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.74e-09	51	337	47	335	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	0.008	108	302	20	204	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW42642.1|GH93	3.51e-226	46	338	87	379
QMW30589.1|GH93	3.51e-226	46	338	87	379
QRD89469.1|GH93	3.51e-226	46	338	87	379
BAE60328.1|GH93	3.51e-226	46	338	87	379
UDD59403.1|GH93	3.51e-226	46	338	87	379

PDB Hits     

AO090012000101-T-p1 has no PDB hit.

Swiss-Prot Hits     

AO090012000101-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AO090012000101-T-p1.