CAZyme Information: AO090012000041-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090012000041-T-p1
• CAZy Family: GH2
• CAZyme Description: Has domain(s) with predicted catalytic activity, chitin binding, chitinase activity, hydrolase activity, hydrolyzing O-glycosyl compounds activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1214	Chr4_A_oryzae_RIB40|CGC29	131126.98	5.5591

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr4_A_oryzae_RIB40:85234-89107(-)

Full Sequence      

MRPSFVLLAFLLGFASAVTESYNGQYADNCPSLCAHAGPSPANWTNNHHVRNLESCDQTV
LFGLNIHNSVTDPNTILTIRACVASHGQTYEAAASPDVPQQPSQHNLVVAESCGAKVVKT
AFTPQVGPSTLSKASSPAPQSTHVAEATRQLALFVDKSAECGTTILFAKHKSAVVGVYSG
AQITKHAVRGFLDSFAEKQTSTVQICQPASAALTVGVASAGFVDLAAAQVAIKDWNNGLC
LDETIPATPVSMDVLVSTVDNSFNAPTNTTTISHGNMTARGKPQALLPRGECRTEEVHGG
DSCASLASRCGISGNDLSKYNPQKNLCSTLKPKQYVCCNAGTLPDFRPRPQPDGTCNTYK
VSDNDNCSDVADAHYLTQQDIEDFNKDTWGWAGCAHLQSGQLICLSEGTPPMPSPVQGAT
CGPQVPGTEKPSNGTALADLNPCPLNACCDAWGFCGTTVDFCTKSPADTGAPGTAKPGTN
GCISNCGMEIVNNGKAPDQLKTIGYFEAFDQTRVCLRMSVKEIPANKYSHIHFAFATVTS
SFDVDISDVEYEFSRFVKMSGFKKILTFGGWAFSTEADTFQRFRDATKKEHRETFVNNLV
SFMNRKNLDGFDFDWEYPGAPDIPDITPGSPEEGDNYLAFLQLLRSKLPSEKSLSLAVPA
SYWYLKQYPVKDIAKYVDYFIYMTYDLHGQWDVDNKSSMPGCPAGNCLRSHINKTETHDA
MVMITKAGVEARQLVIGITSYARSFRMTDASCSGPFCTFAGDKRHSMAYAGPCTTTGGYI
SNAELNDIIKNPGNYSIVKSYIDKDSDSNILMYGNPGAVDWAAYMDSDLKTNRINWIKGL
NFGDSLDSGCVHLFALDILYSQLLDSLSLFQANSEGYDDKFGWYEKWTKEQIQPRIDTFM
KLGDGKGLKYFDCYWAYTDGKEKKDSCLGMPHIWDVNAGWSIRYDLVDKKGFFDALAAET
GIDESWVAFGETSDYTCADPGDPRPGTGGLPCRKLFQKKLNYPQKGSDDKVHVGNPKKLI
EASLGNVTALRTSLLSSYLSVGLSFYDDGPNDTSATDAVVAYSMPILQLTEAINSMKDIK
EIGEDAKEQAKKDLIFKILTIVFMVIPFVGEALGPLIGSAASVARIALLIGEAGNGALTV
ADIIEDPSSAPFAVLGLIAGVGGGSGKLSKAEALAEASKARGLLKGSDLAKFPQRFRDQD
ALVQKVVKSLCARS

Enzyme Prediction     

EC	3.2.1.14:3	3.2.1.14:3	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	501	843	4.1e-51	0.8986486486486487

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	0.0	501	847	1	339	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	1.66e-60	501	843	1	324	Glyco_18 domain.
395573	Glyco_hydro_18	5.39e-51	501	826	1	307	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.47e-42	523	757	21	282	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119349	GH18_chitinase-like	3.26e-40	503	687	2	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE60282.1|CBM18|CBM50|GH18	0.0	1	1214	1	1214
QKX54053.1|CBM18|CBM50|GH18	0.0	32	1213	3	1238
QGA13088.1|CBM18|CBM50|GH18	0.0	1	1213	31	1294
QMW30533.1|GH18	0.0	488	1205	1	772
QRD89398.1|GH18	0.0	488	1205	1	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GZT_B	1.55e-21	494	754	271	547	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
6G9C_A	2.62e-21	525	843	59	363	Crystal structure of immunomodulatory active chitinase from Trichuris suis, TsES1 [Trichuris suis],6G9C_B Crystal structure of immunomodulatory active chitinase from Trichuris suis, TsES1 [Trichuris suis],6G9E_A Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_B Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_C Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_D Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_E Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_F Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis]
3W4R_A	6.71e-21	491	838	16	362	Crystal structure of an insect chitinase from the Asian corn borer, Ostrinia furnacalis [Ostrinia furnacalis]
6JM7_A	7.36e-21	517	841	22	338	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
3WL1_A	7.54e-21	517	838	25	344	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	1.05e-113	301	821	199	685	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|Q95M17|CHIA_BOVIN	6.23e-23	487	846	9	358	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|P36362|CHIT_MANSE	1.06e-19	517	838	41	360	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|Q6RY07|CHIA_RAT	1.11e-18	487	846	9	358	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
sp|Q9BZP6|CHIA_HUMAN	2.01e-18	487	846	9	358	Acidic mammalian chitinase OS=Homo sapiens OX=9606 GN=CHIA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000194	0.999788	CS pos: 17-18. Pr: 0.9806

TMHMM  Annotations     

There is no transmembrane helices in AO090012000041-T-p1.