CAZyme Information: AO090012000003-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090012000003-T-p1
• CAZy Family: GH18
• CAZyme Description: Has domain(s) with predicted catalytic activity, hydrolase activity, hydrolyzing O-glycosyl compounds, sulfuric ester hydrolase activity and role in carbohydrate metabolic process, metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1207	Chr4_A_oryzae_RIB40|CGC1	134855.66	5.2649

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr4_A_oryzae_RIB40:12171-16351(+)

Full Sequence      

MVGKWHLGESVDNQPTGFDYWSVLPGQGLYWDPDFIEPTGERVESGYVTDIITDKSLDWI
KSRDRDRPFFLMCHHKAPHRSWECDDKHKHLYKDPVRLPDTFTDDYKNRAKAAKIAKMRV
AEDLTYQDLGLVQPDGGRRVGEPVLQEFGSSERKVPVPGSIAELQSMRLIDKDDGTVFTF
KSHAELAEFKFQRYMQRYIRTIQSIDDNVGRMLDYLDSEPQLAENTIVVYTSDQGFFLGE
HGWFDKRFMYEESFQMPFLIRYPKEIIAGSVCDDIICNVDFAPTWLDYANLPAPSYMQGT
SFRPLLQGRTPESWQQVAYHRYWMHNDIIHHAYAHYGIRNQRYKLIYWYNEPLDVPGARP
GGKEHKEWELFDCDKDPLELFNVYHEGEYQGVVRQMTTLLEKKMAEIGDEPVHPKPQWLL
GLVFAWRTFKYMSIHADGKLLPPFGQVEAFLFKLCVTAIAHYALAASVHSEMSVGTLHRE
RAEALLSQMTWEEKVGQMGGIRRLLNTGPEIDEENYEYRQAEYQNGNIGFGATLNWADGI
LPLTNEVRQRQINESRLHIPFITVTDSINSLYLSGGTIFPSNLAMAATFNIPLFSEGVAA
LREEQIAIGVSWVLSPPLDIAWEPRYSRIGELFGEDSYLTGEFGHAYVQTMQDKDDSGNI
KVATTVKHFVYGESRGGINAASMYGGINHLYNDQLRPYLRALEADPAAVMVSYASVDLVP
MSANKYLVRDILRQRLGFEGIVMSDAGGIAHLYTESRLAGSYAEAALLALEAGLQMELSP
QSPAVFPTLVAAAEDSHVGQLIDEAVLNILQLKFATGVFDKPLPDPAKVNETLRTPAHLE
ISRHVTRESIVLLQNDGILPTTPSKVALLGPFADIRNYGSYAPVNSSDSRYGNSLYQSLQ
AKLGTSNVTLVQGVDFIDIDTTNIATAVSAAKEAGLAIIVLGSLSVGTTDPLVTKRTDGE
FFTHANLGFPGAQQQLLDAVLDASIPTILVLSGGQPFVLNNSTLRSNAILHSFLGGEFTG
DALAEIIMGDVNPSGKLPISLPQDTSATPVFYDYLPSDDTGTADSILGFHSTYQFPLLSR
SPPMPFGFGLSYTDFTISAPRARASNSSVEVRVNITNVGPIAGKEVVQLYHRPNTTTGIE
FPVKRLVRFEKVDLHAGEGREVRFVIPHKDLGYYVDGELRVKRGVYSFWAGTSSRTEDLK
RVNVTVL

Enzyme Prediction     

No EC number prediction in AO090012000003-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	553	778	1.1e-52	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
293755	G6S_like	7.00e-161	1	401	97	427	unchracterized sulfatase homologous to glucosamine (N-acetyl)-6-sulfatase(G6S, GNS). N-acetylglucosamine-6-sulfatase also known as glucosamine (N-acetyl)-6-sulfatase hydrolyzes of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate. Deficiency of N-acetylglucosamine-6-sulfatase results in the disease of Sanfilippo Syndrome type IIId or Mucopolysaccharidosis III (MPS-III), a rare autosomal recessive lysosomal storage disease.
185053	PRK15098	4.56e-110	453	1174	3	733	beta-glucosidase BglX.
224389	BglX	1.27e-62	489	905	1	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
293751	SGSH	6.66e-54	3	404	98	372	N-sulfoglucosamine sulfohydrolase (SGSH; sulfamidase). N-sulfoglucosamine sulfohydrolase (SGSH) belongs to the sulfatase family and catalyses the cleavage of N-linked sulfate groups from the GAGs heparin sulfate and heparin. The active site is characterized by the amino-acid sequence motif C(X)PSR that is highly conserved among most sulfatases. The cysteine residue is post-translationally converted to a formylglycine (FGly) residue, which is crucial for the catalytic process. Loss of function of SGSH results a disease called mucopolysaccharidosis type IIIA (Sanfilippo A syndrome), a fatal childhood-onset neurodegenerative disease with mild facial, visceral and skeletal abnormalities.
293765	ARS_like	2.00e-48	1	407	96	408	uncharacterized arylsulfatase. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE60251.1|GH3	0.0	1	1207	1	1207
QRD89367.1|GH3	0.0	1	1207	1	1205
UDD59312.1|GH3	0.0	458	1207	12	761
QMW30508.1|GH3	0.0	458	1207	12	761
QMW42566.1|GH3	0.0	458	1207	12	761

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5G2V_A	3.88e-93	1	409	122	513	Structure of BT4656 in complex with its substrate D-Glucosamine-2-N, 6-O-disulfate. [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	1.86e-84	480	1200	16	749	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.22e-83	480	1200	16	749	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
6R5I_A	1.06e-82	484	1198	9	727	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	5.07e-82	484	1198	9	727	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q89YS5|GLCSF_BACTN	3.88e-92	1	409	146	537	N-acetylglucosamine-6-O-sulfatase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4656 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	2.89e-81	546	1206	52	722	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	1.28e-80	485	1174	41	733	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	6.10e-80	485	1194	41	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH9|PLH34_FORAG	9.14e-75	480	1194	38	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000001

TMHMM  Annotations     

There is no transmembrane helices in AO090012000003-T-p1.