CAZyme Information: AO090011000757-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090011000757-T-p1
• CAZy Family: GH18
• CAZyme Description: Ortholog(s) have glucan endo-1,6-beta-glucosidase activity and role in glucan catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	Chr7_A_oryzae_RIB40|CGC7	46614.29	5.5621

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr7_A_oryzae_RIB40:1935166-1936491(-)

Full Sequence      

MKVTRLAVLNTLATLTVAWLPTTDKTITSSNGTDLFKASHGKIRGVNLGSQFVFEPWIAT
KAWSELGCEGQESEFDCVMKLGQDAANKAFAKHWDSWITKEDIKEIRSYGLNTIRIPVGY
WMNEDLIYHDSEYFPHGGFAYLEKLCGWASDAGLYIIIDLHGAPGAQVAKNAFTGQFADT
PGFYVDFQYQRALEFLEWMTIKVHTLHNFRNVGMLEVVNEPVQNPQVTTTLRSNYYPNAF
HSIRKVEGALSIDRKDYLHIQMMDGAWGAGDPHEHLTDDYYAAYDNHRYLKWDPRVEVSK
DSYIKTSCNDNVATNWPAIIGEWSLGVPDNVQETADWKPYSNLDFYQKWFAAQVQNYEQH
QGWIFWTWKTQLDEYRWSYRDGVKAGVIPTDLNAVFREDVCKGRSS

Enzyme Prediction     

EC	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	82	380	1.8e-157	0.9966666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.29e-24	42	381	17	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	8.54e-11	95	368	22	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW47496.1|GH5_15	2.82e-317	1	406	1	406
QRD91854.1|GH5_15	2.82e-317	1	406	1	406
BAE65206.1|GH5_15	2.82e-317	1	406	1	406
QMW35434.1|GH5_15	2.82e-317	1	406	1	406
UDD64545.1|GH5_15	1.27e-316	1	406	1	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	8.14e-35	43	389	9	379	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	2.35e-34	43	389	14	384	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
4M80_A	2.35e-34	43	389	14	384	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
1CZ1_A	2.98e-34	43	389	9	379	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3N9K_A	3.25e-34	43	389	14	384	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TZQ9|EXGB_ASPOR	5.00e-318	1	406	1	406	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgB PE=3 SV=1
sp|B8NBJ4|EXGB_ASPFN	9.11e-298	1	386	1	386	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgB PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	6.33e-209	12	401	14	403	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	9.03e-208	5	401	4	399	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	2.99e-198	5	383	4	381	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000281	0.999708	CS pos: 18-19. Pr: 0.9711

TMHMM  Annotations     

There is no transmembrane helices in AO090011000757-T-p1.