CAZyme Information: AO090011000555-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090011000555-T-p1
• CAZy Family: GH18
• CAZyme Description: Has domain(s) with predicted hydrolase activity, hydrolase activity, acting on ester bonds activity and role in lipid metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261	Chr7_A_oryzae_RIB40|CGC4	29935.32	9.6737

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr7_A_oryzae_RIB40:1406734-1407519(+)

Full Sequence      

MWLRRRVNFSVKLYKTAVGFCFRGGRYFRRTVRECLLLLPLFSTRLTFHAASTPLHHNFT
VSLVNQVAQYRAYGHPVLKDIVEPSRALVAIWIGINDINDSAKYAVRFPTFYNELMDILF
ASVRVLHSLGYRSYLFMNLPPLDRTPSNQKTTSPSPNATQVAWFNKALAQHAGSFDKQYP
DTNVLLFDANSVLNDMMDQPARHGITNTTSFCPGYDQPDIEWNYRAYGCPMPLDTYFWFN
SGHLTSHVHKLLAKALESTLK

Enzyme Prediction     

No EC number prediction in AO090011000555-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	48	256	3.4e-70	0.7453183520599251

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	4.23e-53	49	259	68	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	1.15e-23	60	256	97	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	1.08e-13	58	260	129	333	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	5.73e-13	60	253	83	274	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	3.27e-04	85	192	78	192	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE65038.1|CE0	8.52e-199	1	261	1	261
QRD91661.1|CE0	8.45e-155	53	261	128	336
UDD64353.1|CE0	8.45e-155	53	261	128	336
QMW35262.1|CE0	1.01e-154	53	261	133	341
CAK37535.1|CE0	6.71e-105	53	261	107	315

PDB Hits     

AO090011000555-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	8.57e-15	47	261	99	298	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	8.57e-15	47	261	99	298	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|Q9LU14|APG2_ARATH	1.15e-07	58	256	125	344	GDSL esterase/lipase APG OS=Arabidopsis thaliana OX=3702 GN=APG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999919	0.000123

TMHMM  Annotations     

There is no transmembrane helices in AO090011000555-T-p1.