CAZyme Information: AO090011000349-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090011000349-T-p1
• CAZy Family: GH18
• CAZyme Description: Ortholog(s) have carbon-oxygen lyase activity, acting on polysaccharides activity and role in pectin catabolic process, sporocarp development involved in sexual reproduction

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
568		61809.11	4.6580

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr7_A_oryzae_RIB40:892953-895305(+)

Full Sequence      

MVWALETSKTHVGANIKRQWPTIWRIYRKGIQFCRKLTDKMLSRTILFSTSFLWVRVANA
AFGITTSDDSYVIDAGSANPLKFTVSRSSCDITSINYYGSELQYSGTGSHIGSGLGSADV
SAVEDGDYIKVTCDTDTLTQYFVVHNGDSVIHMATYTTEEPSVGELRFIARLNSELLPNE
EPFGDVSTTSGGEAIEGSDVFLVDGETRSKFYSSQRFIDDQRHCVAGDAHRVCMILNQYE
TSSGGPFFRDINSNNGGSYNSLYWYMNSGHVQTEDRRQGLHGPYSMYFSRSGTPSTDIDT
SFFANLDIKGYVATDGRGTVSGTASGADSSFKWVVHWYNADAQYWTYTSSDGSFTSPAMK
PGDYTMVYYQGEYKVAETSVSVTVGSSTSKDISGSVETGDTIFKIGDWDGTPTGFRNAEN
QLRMHPSDSRMSSWGPLTYTVGSSELTDFPMAAFKGVNDPVTIKFTATSAQTGAATLRIG
TTLSFAGGRPQATINDYEGSAPSAPTNLNSRGVTRGAYRGLGEVYDVNIPSGTIVEGENT
ITISVISGSSGDEFLAPNFIFDCVELFQ

Enzyme Prediction     

EC	4.2.2.23:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	59	557	1.3e-217	0.9959919839679359

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401282	RhgB_N	1.36e-141	62	310	1	251	Rhamnogalacturonan lyase B, N-terminal. Members of this family are found in both fungi, bacteria and wood-eating arthropods. The domain is found at the N-terminus of rhamnogalacturonase B, a member of the polysaccharide lyase family 4. The domain adopts a structure consisting of a beta super-sandwich, with eighteen strands in two beta-sheets. The three domains of the whole protein rhamnogalacturonan lyase (RGL4), are involved in the degradation of rhamnogalacturonan-I, RG-I, an important pectic plant cell-wall polysaccharide. The active-site residues are a lysine at position 169 in UniProtKB:Q00019 and a histidine at 229, Lys169 is likely to be a proton abstractor, His229 a proton donor in the mechanism. The substrate is a disaccharide, and RGL4, in contrast to other rhamnogalacturonan hydrolases, cleaves the alpha-1,4 linkages of RG-I between Rha and GalUA through a beta-elimination resulting in a double bond in the nonreducing GalUA residue, and is thus classified as a polysaccharide lyase (PL).
405384	CBM-like	7.02e-62	401	566	1	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.
199905	RGL4_C	4.51e-60	403	567	1	161	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199907	RGL4_N	3.50e-56	60	297	19	265	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405387	fn3_3	2.13e-20	316	389	1	74	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD64159.1|PL4_1	0.0	1	568	1	568
QRD91468.1|PL4_1	0.0	1	568	1	568
BAE64864.1|PL4_1	0.0	41	568	1	528
QMW47158.1|PL4_1	0.0	40	568	1	529
QMW35094.1|PL4_1	0.0	40	568	1	529

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NKG_A	2.72e-318	61	568	1	508	Rhamnogalacturonan lyase from Aspergillus aculeatus [Aspergillus aculeatus]
2XHN_A	2.18e-317	61	568	1	508	Rhamnogalacturonan lyase from Aspergillus aculeatus K150A active site mutant [Aspergillus aculeatus],2XHN_B Rhamnogalacturonan lyase from Aspergillus aculeatus K150A active site mutant [Aspergillus aculeatus],3NJV_A Rhamnogalacturonan lyase from Aspergillus aculeatus K150A substrate complex [Aspergillus aculeatus]
3NJX_A	8.78e-317	61	568	1	508	Rhamnogalacturonan Lyase from Aspergillus aculeatus mutant H210A [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U0Q1|RGLA_ASPOR	0.0	41	568	1	528	Probable rhamnogalacturonate lyase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rglA PE=3 SV=1
sp|Q00019|RGLA_ASPAC	0.0	41	568	1	527	Rhamnogalacturonate lyase A OS=Aspergillus aculeatus OX=5053 GN=rglA PE=1 SV=1
sp|Q0CVU1|RGLA_ASPTN	0.0	41	560	1	520	Probable rhamnogalacturonate lyase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=rglA PE=3 SV=2
sp|A1D9P9|RGLA_NEOFI	0.0	41	568	1	528	Probable rhamnogalacturonate lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rglA PE=3 SV=1
sp|Q4W9T6|RGLA_ASPFU	0.0	41	568	1	528	Probable rhamnogalacturonate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=rglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.977472	0.022516

TMHMM  Annotations     

There is no transmembrane helices in AO090011000349-T-p1.