CAZyme Information: AO090011000063-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090011000063-T-p1
• CAZy Family: GH16
• CAZyme Description: Has domain(s) with predicted alpha-galactosidase activity, catalytic activity, hydrolase activity, hydrolyzing O-glycosyl compounds activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720	Chr7_A_oryzae_RIB40|CGC8	81490.12	6.3178

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr7_A_oryzae_RIB40:193641-195803(+)

Full Sequence      

MALPKTITLQTDVLSVNVYVDDQGAAFLQEVIPLPGSSRPSVSKYFANPYAPLVEVRLAG
EGTAKHKSSKSLIGTYVGTRLRYRSHEIRQHADTHTLNVTLKDPVSNVTIIAHLTIYQST
RVLRATSTIRNDSDNDIVVTQLSSLVLGGLTTGAEKWWSNYVLAVPNNSWFREAQWIDHD
LPSLGIDDYGVYGRPEEHAASLGHYSVSNRGTFSTEGHLPMGLLKRTDNTETWLWQVENN
GSWRWEVGDWKDSVYLAAGGPVETDHDWRQTLYPGQEFTTVPVALCHVLENYEHAFAEMT
RYRRQMRRKHQDHEQLPIIFNDYMNCLMGDPTDEKILALVDPVVRTGAEYFVIDAGWYAD
DSGWWDDVGLWEPSKKRFPMGFRELLLHLKTKGLTPGLWIEPEVIGVRSVVAEQLPYEAF
FQRNGQRIVEKGRYQLDYRNAAVREHMHAVIHRLVTEYGVGYFKFDYNIEVIQGTDINCS
SSGSGQLDHNRAYLQWVTELHDRYPGLVIENCSSGAQRMDYAMLAVHALQSTSDQQDPDR
YAAIAAALPTAVTPEQGAIWAYPQPEWDDETNAMTVVNSLLGRVHLSGRLDKLRPHQFEL
IKQGMDVYRTIRADLPTATAFWPLGLPRWHDEWVALGMAVHTPDNCDSGVRYLAVWRRGG
LDSVELPIPGLRGLRVKAELLYPSTFPCEISWELAQGILHIRIPSKLSARLLKLTSGNVR

Enzyme Prediction     

No EC number prediction in AO090011000063-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	79	635	1.5e-94	0.7892441860465116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269892	GH36	3.96e-81	316	610	2	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
307952	Melibiase	5.28e-27	302	538	28	264	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
225882	GalA	1.44e-21	197	537	170	508	Alpha-galactosidase [Carbohydrate transport and metabolism].
407116	Glyco_hydro_36N	2.41e-08	79	147	72	154	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
269893	GH27	5.91e-06	320	398	5	84	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE64621.1|GH36	0.0	1	720	1	720
QMW46905.1|GH36	0.0	1	719	58	776
QRD91154.1|GH36	0.0	1	719	58	776
QMW34832.1|GH36	0.0	1	719	58	776
UDD63863.1|GH36	0.0	1	719	1	719

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	1.40e-24	89	520	129	538	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	1.85e-24	89	520	129	538	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
3MI6_A	1.00e-19	93	612	130	630	Chain A, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_B Chain B, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_C Chain C, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_D Chain D, Alpha-galactosidase [Levilactobacillus brevis ATCC 367]
4FNQ_A	1.29e-19	79	671	100	684	Crystal structure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
6PHU_A	3.99e-19	93	584	143	599	SpAga wild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G1UB44|MELA_LACAC	7.20e-24	89	520	129	538	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
sp|P43467|AGAL1_PEDPE	8.36e-22	88	523	126	539	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
sp|P43469|AGAL2_PEDPE	2.15e-19	88	613	122	624	Alpha-galactosidase 2 OS=Pediococcus pentosaceus OX=1255 GN=agaS PE=3 SV=1
sp|Q5ARP5|AGALG_EMENI	6.61e-19	82	537	102	550	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1
sp|Q9ALJ4|AGAA_GEOSE	2.66e-18	79	671	100	684	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AO090011000063-T-p1.