CAZyme Information: AO090010000683-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090010000683-T-p1
• CAZy Family: PL1
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN6460, AN12398, A. oryzae RIB40 : AO090023000067, Aspergillus wentii : Aspwe1_0075588, Aspergillus versicolor : Aspve1_0086685 and Aspergillus zonatus : Aspzo1_1970012

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	Chr8_A_oryzae_RIB40|CGC33	38460.53	4.9612

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr8_A_oryzae_RIB40:1622759-1623862(-)

Full Sequence      

MLVAPRRYVYLGTGFSLVLLFWYTFGSPLAQATRIVSPLEPASVPPPTHSASNATLGFQS
ILALSSGPSWRTRGLMAAANLTGLSIHIPPQPPIHPDLVETFETLGSEYIRHPSHGASIA
WLAHLDLIKYTIQADLDTALILEDDADWDVTIRSQMVRIAESVRNLTGTTESETAPYGRD
WDVLWIGHCAEYWEDLFETVFYEDPTACPHKYYFGFAKENIERMPDHQRAVYWSANPVCS
FAYALSRDGSRKVIELLGAGQDEAFDVSMMHACSAGKLKCISVVPEVVHQYFPNQTFGVK
SMVDIGNGEQAGPDDSEFEHIMGSTENILESARCRALWNKRCLRE

Enzyme Prediction     

No EC number prediction in AO090010000683-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	6.66e-04	121	149	68	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48287.1|GT25	3.31e-261	1	345	1	345
BAE66503.1|GT25	3.31e-261	1	345	1	345
UDD65488.1|GT25	3.31e-261	1	345	1	345
QMW36233.1|GT25	3.86e-260	1	345	1	345
QRD92784.1|GT25	4.01e-260	1	345	2	346

PDB Hits     

AO090010000683-T-p1 has no PDB hit.

Swiss-Prot Hits     

AO090010000683-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.610572	0.389437

TMHMM  Annotations     

Start	End
7	26