CAZyme Information: AO090010000612-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090010000612-T-p1
• CAZy Family: GH140
• CAZyme Description: Ortholog of A. fumigatus Af293 : Afu8g02070, A. niger CBS 513.88 : An05g02310, Neosartorya fischeri NRRL 181 : NFIA_095740 and Aspergillus clavatus NRRL 1 : ACLA_043710

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		39434.58	8.5724

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr8_A_oryzae_RIB40:1787805-1788968(-)

Full Sequence      

MICTRARLIVVVTLALILLWLSSSSLLRLYYLLRLPFVWKASSADAIISQEYDDFDVTFT
DYDANYSTYATGIRPYIPRRIHHIHLGASSPPKNWLDARAECLKHHEFWEAHLWTDENAD
SFVRDNYPHLYDMWTSYPFNVQRVDALRYMILQKYGGAVLDFDLACKRSLEPLRRFEFVA
PAAHPAGFSIGVMLAAPNNPFVHALVENLPVYNQVWPLLPYATVMFSTGCHYASTIFTLQ
SNRTNLRILAGPPDQPRMHMLNGVVNTPLFRHFGSSSWHGHDARLIQFFKDLDQRILFAG
LVFVLGSTALIILLCISRRRAPKADDEERRLPSFTIKWMTKIA

Enzyme Prediction     

No EC number prediction in AO090010000612-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	95	174	7.9e-18	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.70e-25	77	229	82	232	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.63e-12	92	177	1	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65563.1|GT32	1.39e-252	1	343	1	343
QRD92706.1|GT32	1.62e-251	1	343	1	343
QMW36301.1|GT32	1.62e-251	1	343	1	343
QMW48357.1|GT32	9.36e-251	1	343	1	343
BAE66443.1|GT32	2.33e-155	133	343	1	211

PDB Hits     

AO090010000612-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	1.35e-34	63	320	50	303	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P38287|CSH1_YEAST	1.12e-33	67	297	52	275	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.72e-32	77	303	55	276	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	2.91e-32	77	331	57	305	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.23e-31	75	306	80	311	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.871927	0.128083

TMHMM  Annotations     

Start	End
9	31
295	317