CAZyme Information: AO090010000387-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090010000387-T-p1
• CAZy Family: GH131
• CAZyme Description: Ortholog of Aspergillus flavus NRRL 3357 : AFL2T_11562

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
201	Chr8_A_oryzae_RIB40|CGC14	22164.63	4.6943

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr8_A_oryzae_RIB40:2324093-2324837(+)

Full Sequence      

MHFKAYILAAIATASTALAHMEMIRPFPLKSQFDPNNDWSNIDYDNTSPLEPSGSNFPCR
GHHKTTSWRTVANYTAGQADYMKLAPGNNHHGGSCQISLSYDNGETFRVIESYMGGCPLK
LEWDFEIPSFAPSGKALFAWSWFNIEGNREMYMNCAQVEIEGGSDSAQFDQLPEIFTANV
GNGCRTVEGDAPFPKCGGNAE

Enzyme Prediction     

No EC number prediction in AO090010000387-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	20	199	5.5e-60	0.9476439790575916

CDD Domains     

AO090010000387-T-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE66259.1|AA11	3.24e-155	1	201	1	201
QMW48536.1|AA11	1.50e-149	1	201	1	222
QMW36481.1|AA11	1.50e-149	1	201	1	222
QRD92486.1|AA11	1.50e-149	1	201	1	222
UDD65764.1|AA11	8.70e-149	1	201	1	222

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	1.90e-25	20	201	1	200	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

AO090010000387-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000384	0.999574	CS pos: 19-20. Pr: 0.9747

TMHMM  Annotations     

There is no transmembrane helices in AO090010000387-T-p1.