CAZyme Information: AO090010000215-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090010000215-T-p1
• CAZy Family: GH13
• CAZyme Description: Has domain(s) with predicted flavin adenine dinucleotide binding, oxidoreductase activity, acting on CH-OH group of donors activity and role in oxidation-reduction process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	Chr8_A_oryzae_RIB40|CGC19	49398.02	4.9422

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr8_A_oryzae_RIB40:2830792-2832459(-)

Full Sequence      

MSGGGTSGIVLAARLSEDDSKSVIIREAGRNLADDFRVQTPALWTTLLGSEADWQLITAP
QTELRNRIIKEPQGKLLGGSSGINGLHRSLQAEIHAWSKSSAIDWTWEKLSPYYKKSYTL
QLPDEATREHIGLGWVDQNVNGDSGPINISFPAVLQDPLSKAWVDTFKGIGYSLTADPFS
GNSIAGYSNLATVDYKTKTRSYAATGYGLPAMQRPGDAGVTATGVKAILQGELSTIKAKK
EVILTAGALNTPKLLELSGIGNKAILDQFNIPVVVENPNVDENIQDYLMSRISSEQEVMQ
NAMQLYTKHKAGPITIEAKQAYLNRFIPQPEGRDQVIRDIYAADNEPTCSIFVGQELLPG
NFLSLGLELSLPYSRGSVHIASADPNVPPTIDPRYFSNPLDLDIMARNLLDFLVYGVTNL
RVCDASVFALVPPANIMSTVYAVAERAADIIKSDA

Enzyme Prediction     

No EC number prediction in AO090010000215-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	408	2e-93	0.7940140845070423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.32e-67	3	452	12	532	choline dehydrogenase; Validated
225186	BetA	4.75e-61	3	455	14	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.18e-18	372	447	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.08e-15	66	265	16	207	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.89e-13	3	402	62	454	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD92392.1|AA3_2	4.21e-215	1	411	1	336
CAK46356.1|AA3_2	8.31e-193	3	454	17	601
QDL52568.1|AA3_2	3.47e-192	3	454	18	602
BCS02826.1|AA3_2	3.13e-190	3	452	17	599
BCS14479.1|AA3_2	3.13e-190	3	452	17	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.02e-44	3	455	12	568	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	2.86e-35	1	454	10	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	1.71e-33	3	454	8	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.03e-32	3	454	9	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
2JBV_A	9.16e-29	3	399	20	409	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	3.83e-55	3	451	53	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	3.83e-55	3	451	53	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A5C1RDA6|ASC9_DIDFA	1.47e-53	3	454	20	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	9.42e-49	3	454	20	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	9.42e-49	3	454	20	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AO090010000215-T-p1.