CAZyme Information: AO090010000207-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090010000207-T-p1
• CAZy Family: GH13
• CAZyme Description: Ortholog(s) have role in GPI anchor biosynthetic process, fungal-type cell wall organization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	Chr8_A_oryzae_RIB40|CGC10	46548.57	8.7894

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr8_A_oryzae_RIB40:2852707-2854116(+)

Full Sequence      

MASLFERPSLVFGAAIVLRAILLVYGAWQDAHSAVKYTDIDYMVFTDAARYVSKGDSPYA
RDTYRYTPLLAWLLLPTSWDGFFSFGKVLFALSDVVAGWLIAKALTSFYGMSPPRALKYA
SVWLLNPMVANISTRGSSEGLLCVLVIALLWAVLNRKITLAGVLLGLSVHFKIYPFVYGP
SIIWWLDEEREGLKSSSQKQKPEQDDRNLLTHIFNFITPSRLLLTTTALATFSGLNISMY
ILYDFPFAQHTYLHHLTRIDHRHNFSPYSSLLYLSAAGDIQGSFESLAFIPQLLLSVVVI
PIVLAKRSLPGAMLAQTFAFVTFNKVCTSQYFLWYLIFLPFYLPSSSLMKNPRLGITVTA
LWVIAQALWLQQGYYLEFLGLSSFVPGLFLASLGFFAVNIWILGIIINDVALEGC

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	132	407	5.8e-98	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	7.02e-88	8	408	9	416	GPI mannosyltransferase
252941	Mannosyl_trans	3.68e-70	132	407	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	3.58e-06	47	201	39	205	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65877.1|GT50	1.07e-297	1	415	1	415
BAE66105.1|GT50	2.74e-297	1	415	26	440
QRD92382.1|GT50	1.77e-296	1	415	1	415
QMW36573.1|GT50	2.30e-296	1	415	8	422
QMW48628.1|GT50	2.30e-296	1	415	8	422

PDB Hits     

AO090010000207-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB8|GPI14_ASPOR	1.89e-298	1	415	1	415	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4WAH2|GPI14_ASPFU	3.20e-228	1	410	1	421	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	9.15e-216	1	410	1	428	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	1.12e-169	1	409	19	484	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	1.06e-161	5	409	7	407	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000011

TMHMM  Annotations     

Start	End
10	28
69	91
132	154
161	183
221	243
283	305
320	342
354	370
385	407