CAZyme Information: AO090010000096-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090010000096-T-p1
• CAZy Family: GH13
• CAZyme Description: Has domain(s) with predicted catalytic activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461	Chr8_A_oryzae_RIB40|CGC5	51074.24	4.6847

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr8_A_oryzae_RIB40:3167258-3168776(+)

Full Sequence      

MWSYFWHIAFTALLTLGRLTAGIQLDINDPNSIKDAAATAAYGMMTYYHGNESGQIPGKL
PGTWWTGGEVFMALVQYWYWTGDTSYNDVTKQALIWQKGHNDYLPDNYTQDLGNDDQVFW
GLAAMTAAELNFPEDEEVSWLALAQGVFNTQAEKWDPDTCHGGLRWQRNSWNGGYDLKNS
VSNGGFFQLAARLARYTKNETYTEWAEKAFTWATSVPLIIEKGWTINDLVTVESNCQAPN
QMQWSYNYGIYFNGAAYMYNLTNGDTKWKNVVEGLLNTTWRNFFPQEYGGNIMVEPCEPQ
KQGVVPCDGNQSTFKSLVTAWLAFTTTIMPETLDQILPKLQGSAEGAAKQCSGPSPDKIC
GQRWFLDKYDGVTGLREHMCALSVFTANMVPFKTGNRDQGPLTADTGGTSKGDPSAGTGS
RKPEKDKPREITTGDRVGASIATVVVVGIWLGIAAFMVTGG

Enzyme Prediction     

No EC number prediction in AO090010000096-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	31	392	3.5e-100	0.9329608938547486

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.27e-172	32	382	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48731.1|GH76	0.0	1	461	1	461
QRD92263.1|GH76	0.0	1	461	1	461
QMW36675.1|GH76	0.0	1	461	1	461
BAE66007.1|GH76	0.0	1	461	1	461
UDD65999.1|GH76	0.0	1	461	1	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.45e-103	27	436	30	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	8.92e-106	8	446	7	436	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	9.17e-102	22	446	18	433	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	3.00e-101	8	446	4	438	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|O74556|YCZ2_SCHPO	5.08e-97	10	417	6	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5ACZ2|DFG5_CANAL	1.87e-96	7	458	6	450	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000645	0.999330	CS pos: 22-23. Pr: 0.9544

TMHMM  Annotations     

Start	End
437	459