CAZyme Information: AO090010000034-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090010000034-T-p1
• CAZy Family: GH128
• CAZyme Description: Glycoside hydrolase family 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848	Chr8_A_oryzae_RIB40|CGC8	93174.83	5.8687

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr8_A_oryzae_RIB40:3317519-3320279(+)

Full Sequence      

MSFVESVPDRVANGFDRIATADIEQIIQQLTRDEKVALLTGEDFWHTVPIPRLGIPSIRF
SDGPNGLRGTKFFGSVPSACLPCGTAIGATFDRDLAVRIGHLLAAEAKAKGAHVVLGPTI
NIPRGPLGGRGFESFSEDPLLSGIIAGNYCKGLKEKNIIATLKHFVCNDQEHERMAVNSL
VTDRALREIYLLPFMTAIAIGEPDAIMTAYNKVNGIHAAESPKLLQDILRGEWGWDGLLM
SDWFGTYSTTESIQASLDLEMPGPTRWRGSALAHVITANKVSMATVNARVRAVLRLVQKA
SRSGIPERAPEGQLNREEDRRLLRKIASEAIVLMKNEEGILPLDKRRRVAVIGPNAQVAT
YCGGGSAALNPYFAVTPFEGITNAALEGVDFAQGVYGHENLPLLGKRLRTPDGHTGFVLR
IFNEPPTATTRVPIEERLETDAMVFFLDYSHPHLQSTWYADAEGYFTPDESGLYDFGLCV
QGTGKLYVNGHLLINNVDVQTPGSSFLGSGTVEERESIQLEAGREYKIQVQWGCAKTGKF
KVPGVVDFGHGGFRFGACKRLSPAEGIEEAVRLAARVEQVILTAGLSAEWESEGEDRTTM
SLPPHTDQLIERVLAANPNTIIVLQSGTPVEMPWIHQAKAVMHAWYGGNETGNAIADVIF
GDVNPSGKLPLTFPRRLKDNPTYFNYRSEGGRVLYGEDVYVGYRFYDEADIDPLFPFGHG
LSYTTFELSSLELTKGSSHNMKVKCTLRNTGQRAGAEVIQLYVAPVSPPVKRPLKELKEF
RKVWLAQSAEEVITIPVDLIRATSFWDETSSSWCSYQGTYRIMVGTSSRGNFLEDSVELG
ETTFWSGN

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	50	262	3e-63	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.01e-88	52	829	101	755	beta-glucosidase BglX.
224389	BglX	1.37e-74	42	389	47	391	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.03e-60	331	723	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	9.92e-45	26	825	56	769	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.55e-41	48	296	59	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE65953.1|GH3	0.0	1	848	1	848
QRD92200.1|GH3	0.0	1	848	1	848
QMW36733.1|GH3	0.0	1	848	1	848
QMW48789.1|GH3	0.0	1	848	1	848
UDD66060.1|GH3	0.0	1	848	1	848

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.79e-254	22	847	5	844	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	7.21e-249	22	847	5	844	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.10e-145	22	842	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.89e-111	27	829	9	653	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.01e-105	20	828	51	817	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	0.0	22	847	5	838	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B0Y8M8|BGLJ_ASPFC	0.0	23	847	14	864	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|Q5BB53|BGLI_EMENI	0.0	22	847	5	838	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|Q0CAF5|BGLI_ASPTN	0.0	22	847	5	838	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	0.0	22	847	5	837	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000001

TMHMM  Annotations     

There is no transmembrane helices in AO090010000034-T-p1.