CAZyme Information: AO090009000554-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090009000554-T-p1
• CAZy Family: GH12
• CAZyme Description: Glycoside hydrolase family 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
964		105205.19	4.4875

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr1_A_oryzae_RIB40:1458436-1462147(-)

Full Sequence      

MTYFDSIAEAELELLSASRQYDGVDDDDDDSDGYGVGVKRGQRQGLLKRTHDGRTGWRTV
YYSKYWWRALIGVVVVLVLLVLVFLGLARSKQVGDELDYSMIPAESWFPSPRGGALKEWA
ADYQKAALLVGNMTLIEKVNITTGTGWQMGLCVGNTGPAESVHFPSLCLQDGPMGIRYAD
HISAFPPGLTTGATWNRDLIRERGIAMGLEARLKGVNVLLGPSMGPLGMMPAGGRNWEAF
GSDPVLQGVAAAETIKGIQSNGVMATAKHFVMNEQEHFRQPFEWGIPTALSSNVGDRALH
EVFAWPFAESIRADVASVMCAYQMVNNSHACENSKLLNGILKDELGFQGFVQSDWLAQRS
GINSALGGLDMSMPGDGLHWADGKSLWGSELTRAVLNTSIPMERLNDMVTRIVAAWYHLG
QDQWERPPPDGEGGPNFSSWTDDQTGWWQQASVEAGDQDGGWGIVNKYVDAGAGHGDIAR
KVAAEGIVLVKNNNNTLPLSRSPPSPYRIGIYGDDAGPALGPNACPDRGCSQGTLASGWG
SGTVEFPFLVSPLEALQGAWETEVEITPYLQNMVMPVSVQDKDLCLVFANANSGEGYIHA
GGIHGDRNDLFLQKGGDTLIQAVANNCAGPTVVVVHAVGPVVVESWIDLPGVDAVLFAHL
PGQESGNALVDVLFGDVDASGRLPYTVGKSLEDYGPGAQVLYENNAPVPQVDFLDALYID
YRYFDKFNITPRYEFGFGLSYTSFELSKLYIKSMQWKSRLPKSRPQDQVSPPEYDTRPPV
NENVLFPEGFHALSKYVYSYLPSLDGTAAANYTEYPDGYDLPRQPSEAGGDLGGNPSLYE
EMAKVQVQVANTGARAGQTVVQAYVSFPSDVVEEGDLVEVPVDEKGETVTFVPSKEQVEF
PDRVLRNFTKIALEPGEKKTVEMTLSRKDLSYWSARQQNWVMPDGDFQIWVGQSSRDLPL
HGKY

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	160	374	2.9e-56	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.06e-46	183	539	81	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.25e-44	487	741	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	1.36e-39	181	957	116	756	beta-glucosidase BglX.
395747	Glyco_hydro_3	5.28e-27	185	412	88	313	Glycosyl hydrolase family 3 N terminal domain.
405066	Fn3-like	5.57e-23	860	955	2	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE54990.1|GH3	0.0	1	964	1	964
QMW37281.1|GH3	0.0	3	964	87	1048
QMW25221.1|GH3	0.0	3	964	87	1048
QRD88836.1|GH3	0.0	3	964	87	1048
UCK57595.1|GH3	0.0	3	964	87	1048

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FJJ_A	1.69e-238	95	963	2	837	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
4IIB_A	5.89e-236	95	961	1	834	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
6SZ6_A	8.98e-234	104	960	4	831	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5JU6_A	2.00e-232	88	960	13	847	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5FJI_A	2.35e-230	107	960	9	836	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UTX5|BGLE_ASPOR	0.0	3	964	87	1048	Probable beta-glucosidase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglE PE=3 SV=2
sp|A1CMH6|BGLE_ASPCL	0.0	2	964	105	1050	Probable beta-glucosidase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglE PE=3 SV=1
sp|B0YD91|BGLE_ASPFC	0.0	2	964	94	1033	Probable beta-glucosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglE PE=3 SV=1
sp|Q4WD56|BGLE_ASPFU	0.0	2	964	94	1033	Probable beta-glucosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglE PE=3 SV=1
sp|A1DLJ5|BGLE_NEOFI	0.0	2	964	96	1045	Probable beta-glucosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999975	0.000049

TMHMM  Annotations     

Start	End
65	87