CAZyme Information: AO090009000381-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090009000381-T-p1
• CAZy Family: GH115
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN4084, A. fumigatus Af293 : Afu1g05595, A. niger CBS 513.88 : An18g04440, Aspergillus wentii : Aspwe1_0025280 and Aspergillus sydowii : Aspsy1_0149732

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641	Chr1_A_oryzae_RIB40|CGC23	74195.20	6.8181

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr1_A_oryzae_RIB40:1018730-1020707(+)

Full Sequence      

MQALTMSLVHKNRVHAFSSFSIMHRDSPPGGRMRRQRLVVSLATVVFVCISLILLRDTTV
PRLSNGLNAPFEANPLPSSYPPSPSVAVPNPIEPSKGRQALHPQNVHPMSSLIKDAEQEF
SHLQSRQSKTLADAVKEYRRRYNMHPPPHFDKWFQFAQAKGVQLIDEYDTIYHSLLPFWS
LEPKTIRERAREALGYDNSVIGVLIRDGKVTHTEGGREGYEWQQDATVDMMQSFIRYLPN
MDLVFNTHDEPRVIVPSDDLQRLVNFAKDHVIPKAFHDQPLVNKWSDKPADLNKGDRVDE
VRTTRFNRFAHQPTWTSSRASCPLDTPARSLNESEPDNLEAYAYGDLGFIYNTTAFSDIC
NTPSLRYKYGFFDRANAFDVVRDLFPVFSQSKISSFQDILYPSPWYWADKVPYEEGKDHS
WDAKADKLYWRGSTTGGFARAGGWRRQHRQRFVSNINTQSTAKVLSKNGNDQWELNEVNF
DPYRDQFDVKFTYIGQCDPNDCAAQQEYFVVGEPAGQQDAWAFKYLVDIDGNAFSGRYYA
FLRSHSLVFKIAVFREWHDEWLKPWVHYVPLSLTGDEYVETTRYFISEEEGRTAAPRLAQ
QSRDWAQKSLRREDLEVWFFRLLLEYGRLVDDNRENLGFSL

Enzyme Prediction     

No EC number prediction in AO090009000381-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	362	630	1.3e-80	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	3.39e-19	386	629	32	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	8.09e-07	386	629	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UCK57446.1|GT90	0.0	23	641	1	619
BAE54850.1|GT90	0.0	33	641	1	609
QMW37147.1|GT90	0.0	33	625	1	593
QMW25089.1|GT90	0.0	33	625	1	593
QRD88986.1|GT8|GT90	0.0	1	592	1	592

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	4.10e-09	386	630	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	2.31e-06	386	633	118	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	7.56e-57	107	636	152	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q29AU6|RUMI_DROPS	2.26e-09	386	630	164	389	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|Q8T045|RUMI_DROME	2.17e-08	386	630	166	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	3.72e-08	382	630	160	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	1.14e-07	518	630	276	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999957	0.000054

TMHMM  Annotations     

Start	End
38	55