CAZyme Information: AO090009000173-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090009000173-T-p1
• CAZy Family: GH106
• CAZyme Description: Ortholog(s) have 1,3-beta-glucanosyltransferase activity and role in fungal-type cell wall organization, pathogenesis

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538		57355.50	4.5145

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr1_A_oryzae_RIB40:451787-453568(-)

Full Sequence      

MKLSSIVAGASLFASSVIAADLDPIIIKGSKFFYKSNDTQFYIRGVAYQQEYSGPDSSAN
SFKDPLADADACKRDVPYLEKLGTNTIRVYAIDPKSDHKECMSLLSDAGIYVIADLSSPG
DSINRNEPKWDNDLYNRYVTVVDELSQYSNVIGFFAGNEVSNSENTTSASAFVKAAVRDT
KQYIKAKNYRSMGVGYATSDDSSIRKNMANYFNCNGADDSIDFWGYNVYSWCGDSNYEKS
GYASRTEEFKDYTVPVFFAEYGCNAVQPRKFTEVQALYGDKMADVWSGGIVYMYFQEENN
YGLVSVDGNKVSTKADFSYLSKELASATPSGTKKGDYQPTNTALQSCPTVDDKWLATSSP
LPPSPNQDLCSCMEESLSCALKDKVSGEQLDKLFGTVCGYDVCDGITTNATTGKYGAYSV
CTPQQQLSYAINLYYQNQKAKGNGDKACDFNGAATTQSSKSGGSACSALLKEAGTSGTGT
VTSSPTGTAGSGASDGAAASSSGSAGGLVAPSSVNVGIFQLGAYVVTAMVAGAGMIVL

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	20	326	4.7e-138	0.9871794871794872
CBM43	378	466	2.7e-19	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	3.56e-163	14	327	1	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	5.14e-28	377	455	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	1.11e-16	377	468	1	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE54670.1|CBM43|GH72	0.0	1	538	1	538
QRD89178.1|CBM43|GH72	0.0	1	538	1	538
QMW24910.1|CBM43|GH72	0.0	1	538	1	538
QMW36910.1|CBM43|GH72	0.0	1	538	1	538
UCK57245.1|CBM43|GH72	0.0	1	538	1	538

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	3.73e-125	15	451	25	469	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	1.05e-124	15	451	25	469	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	1.05e-124	15	451	25	469	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ATC3|GAS1_ARTBC	1.63e-225	1	538	1	545	1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07487 PE=1 SV=1
sp|B0XVI5|GEL4_ASPFC	7.63e-185	1	538	1	548	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	7.63e-185	1	538	1	548	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|P0C955|GEL3_ASPFU	6.18e-183	5	473	4	468	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XT09|GEL3_ASPFC	6.84e-183	5	473	4	468	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000656	0.999301	CS pos: 19-20. Pr: 0.9709

TMHMM  Annotations     

There is no transmembrane helices in AO090009000173-T-p1.